Mouse Anti-CBFA2T2 Monoclonal Antibody – Cat# MBS6199916

CBFA2T2 Antibody – Mouse Monoclonal

Name: CBFA2T2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6199916
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199916

MBS6199916 is an antibody targeting CBFA2T2. Also known as CBFA2T2 (EHT, MTGR1, Protein CBFA2T2, ETO Homologous on Chromosome 20, MTG8-like Protein, MTG8-related Protein 1, Myeloid Translocation-related Protein 1, p85) (MaxLight 490). Reactive in Human. Host:… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CBFA2T2, Monoclonal Antibody

Full Product Name

CBFA2T2 (EHT, MTGR1, Protein CBFA2T2, ETO Homologous on Chromosome 20, MTG8-like Protein, MTG8-related Protein 1, Myeloid Translocation-related Protein 1, p85) (MaxLight 490)

Product Gene Name

anti-CBFA2T2 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

2C10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CBFA2T2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa201-304 from CBFA2T2 (NP_001028171.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLE

Conjugate

MaxLight490

Product Categories/Family for anti-CBFA2T2 antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-CBFA2T2 antibody

FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)

Application Notes for anti-CBFA2T2 antibody

IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CBFA2T2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CBFA2T2. It may not necessarily be applicable to this product.

NCBI GI #

1677499637

NCBI GeneID

9139

NCBI Accession #

NM_001032999.3

UniProt Related Accession #

O43439

GenBank Nucleotide #

NM_001032999

NCBI Official Full Name

Homo sapiens CBFA2/RUNX1 partner transcriptional co-repressor 2 (CBFA2T2), transcript variant 3, mRNA

NCBI Official Synonym Full Names

CBFA2/RUNX1 partner transcriptional co-repressor 2

NCBI Official Symbol

CBFA2T2

NCBI Official Synonym Symbols

EHT; p85; MTGR1; ZMYND3

Protein Family

Protein

NCBI Protein Information

protein CBFA2T2

NCBI Summary for CBFA2T2

In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described. [provided by RefSeq, Jul 2008]

Research Articles on CBFA2T2

1. in human colorectal cancer (CRC) samples MTGR1 was downregulated at both the transcript and protein level. Overall data indicates that MTGR1 has a context-dependent effect on intestinal tumorigenesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.