Mouse Anti-CCL17 Monoclonal Antibody – Cat# MBS6199937

CCL17 Antibody – Mouse Monoclonal

Name: CCL17 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6199937
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199937

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CCL17, Monoclonal Antibody

Full Product Name

CCL17 (SCYA17, TARC, C-C Motif Chemokine 17, CC Chemokine TARC, Small-inducible Cytokine A17, Thymus and Activation-regulated Chemokine, MGC138271, MGC138273) (MaxLight 490)

Product Gene Name

anti-CCL17 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

1F11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CCL17.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

10 kDa

OMIM

601520

3D Structure

ModBase 3D Structure for Q92583

Immunogen

Partial recombinant corresponding to aa24-95 from human CCL17 (NP_002978) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Conjugate

MaxLight490

Product Categories/Family for anti-CCL17 antibody

Antibodies; Growth Factors; Cytokines

Applications Tested/Suitable for anti-CCL17 antibody

FLISA

Application Notes for anti-CCL17 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CCL17 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CCL17 purchase

MBS6199937 is an antibody targeting CCL17. Also known as CCL17 (SCYA17, TARC, C-C Motif Chemokine 17, CC Chemokine TARC, Small-inducible Cytokine A17, Thymus and Activation-regulated Chemokine, MGC138271, MGC138273) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CCL17. It may not necessarily be applicable to this product.

NCBI GI #

4506829

NCBI GeneID

6361

NCBI Accession #

NP_002978

UniProt Primary Accession #

Q92583

UniProt Secondary Accession #

Q2M287; A0N0Q9

UniProt Related Accession #

Q92583

GenBank Nucleotide #

NM_002987

NCBI Official Full Name

C-C motif chemokine 17

NCBI Official Synonym Full Names

chemokine (C-C motif) ligand 17

NCBI Official Symbol

CCL17

NCBI Official Synonym Symbols

TARC; ABCD-2; SCYA17; A-152E5.3

UniProt Protein Name

C-C motif chemokine 17

UniProt Synonym Protein Names

CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine

Protein Family

C-C motif chemokine

UniProt Gene Name

CCL17

UniProt Synonym Gene Names

SCYA17; TARC

UniProt Entry Name

CCL17_HUMAN

NCBI Protein Information

C-C motif chemokine 17; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17

NCBI Summary for CCL17

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]

UniProt Comments for CCL17

CCL17: Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: extracellular space; extracellular region

Molecular Function: CCR4 chemokine receptor binding; chemokine activity; receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; multicellular organismal development; immune response; negative regulation of myoblast differentiation; inflammatory response; chemotaxis

Research Articles on CCL17

1. Although TARC and I-TAC may not directly regulate pruritus in atopic dermatitis patients, these chemokines are very sensitive disease markers of AD.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CCL17 antibody

Reference Product	PubMed Publications
CCR4 antibody	>247 publications with CCL17 and CCR4
CXCR3 antibody	>60 publications with CCL17 and CXCR3
CCR5 antibody	>36 publications with CCL17 and CCR5
CCR8 antibody	>34 publications with CCL17 and CCR8
CCR3 antibody	>32 publications with CCL17 and CCR3
CCR7 antibody	>23 publications with CCL17 and CCR7
CCR6 antibody	>20 publications with CCL17 and CCR6
STAT6 antibody	>20 publications with CCL17 and STAT6
CCR1 antibody	>16 publications with CCL17 and CCR1
CCR2 antibody	>12 publications with CCL17 and CCR2

Pathways associated with anti-CCL17 antibody

Products by Pathway	Pathway Diagram
Chemokine Receptors Bind Chemokines Pathway antibodies	Chemokine Receptors Bind Chemokines Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Class A/1 (Rhodopsin-like Receptors) Pathway antibodies	Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
Cytokine-cytokine Receptor Interaction Pathway antibodies	Cytokine-cytokine Receptor Interaction Pathway Diagram
Cytokine-cytokine Receptor Interaction Pathway antibodies	Cytokine-cytokine Receptor Interaction Pathway Diagram
Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway antibodies	Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
IL4-mediated Signaling Events Pathway antibodies	IL4-mediated Signaling Events Pathway Diagram

Diseases associated with anti-CCL17 antibody

Disease Name	Pubmed Publications
Hypersensitivity Antibodies	>293 publications with CCL17 and Hypersensitivity
Inflammation Antibodies	>272 publications with CCL17 and Inflammation
Respiratory Tract Diseases Antibodies	>184 publications with CCL17 and Respiratory Tract Diseases
Dermatitis, Atopic Antibodies	>168 publications with CCL17 and Dermatitis, Atopic
Lung Diseases Antibodies	>153 publications with CCL17 and Lung Diseases
Asthma Antibodies	>136 publications with CCL17 and Asthma
Respiratory Hypersensitivity Antibodies	>118 publications with CCL17 and Respiratory Hypersensitivity
Necrosis Antibodies	>102 publications with CCL17 and Necrosis
Disease Models, Animal Antibodies	>70 publications with CCL17 and Disease Models, Animal
Fibrosis Antibodies	>34 publications with CCL17 and Fibrosis

Organs/Tissues associated with anti-CCL17 antibody

Organ/Tissue Name	Pubmed Publications
Mammary Gland Antibodies	>1 publications with CCL17 and Mammary Gland