• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CER1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200087

Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CER1, Monoclonal Antibody
Full Product Name
CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 490)
Product Gene Name
anti-CER1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E11
Host
Mouse
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CER1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
603777
3D Structure
ModBase 3D Structure for O95813
Immunogen
Full length recombinant protein corresponding to aa158-266 from human CER1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVS
Conjugate
MaxLight490

Product Categories/Family for anti-CER1 antibody

Antibodies; Growth Factors; Cytokines
Applications Tested/Suitable for anti-CER1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-CER1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CER1 antibody

Western Blot detection against immunogen using (37.73kD).
Mouse Anti-CER1 Monoclonal Antibody – Cat# MBS6200087

Immunoprecipitation (IP) of anti-CER1 antibody

Immunoprecipitation of CER1 transfected lysate using and Protein A Magnetic Bead and immunoblotted with CER1 rabbit polyclonal antibody.
Mouse Anti-CER1 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6200087

Other Notes

Small volumes of anti-CER1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CER1 purchase

MBS6200087 is an antibody targeting CER1. Also known as CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (MaxLight 490). Reactive in Human, Mouse. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CER1. It may not necessarily be applicable to this product.

NCBI GI #
4885135
NCBI GeneID
9350
NCBI Accession #
NP_005445
UniProt Primary Accession #
O95813
UniProt Related Accession #
O95813
GenBank Nucleotide #
NM_005454
NCBI Official Full Name
cerberus
NCBI Official Synonym Full Names
cerberus 1, DAN family BMP antagonist
NCBI Official Symbol
CER1
NCBI Official Synonym Symbols
DAND4
UniProt Protein Name
Cerberus
UniProt Synonym Protein Names
Cerberus-related protein; DAN domain family member 4
Protein Family
Cerberus
UniProt Gene Name
CER1
UniProt Synonym Gene Names
DAND4
UniProt Entry Name
CER1_HUMAN
NCBI Protein Information
cerberus

NCBI Summary for CER1

This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein (BMP) antagonists that can bind directly to BMPs and inhibit their activity. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for CER1

CER1: Cytokine that may play a role in anterior neural induction and somite formation during embryogenesis in part through a BMP-inhibitory mechanism. Can regulate Nodal signaling during gastrulation as well as the formation and patterning of the primitive streak. Belongs to the DAN family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 9p23-p22

Cellular Component: extracellular space; extracellular region

Molecular Function: morphogen activity; protein homodimerization activity; cytokine activity

Biological Process: BMP signaling pathway; anterior/posterior pattern formation; negative regulation of cell proliferation; nervous system development; negative regulation of activin receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; ureteric bud development; gastrulation; determination of dorsal identity; bone mineralization; cell migration involved in gastrulation; negative regulation of BMP signaling pathway; anterior/posterior axis specification
Show more

Research Articles on CER1

1. Cerberus binds and inhibits Nodal, Activin B, BMP-6, and BMP-7 but not BMP-2 or Activin A.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CER1 antibody

 Reference Product  PubMed Publications
 NODAL antibody  >19 publications with CER1 and NODAL
 BMP4 antibody  >13 publications with CER1 and BMP4
 GREM2 antibody  >5 publications with CER1 and GREM2
 BMP2 antibody  >3 publications with CER1 and BMP2
 BMPR1A antibody  >2 publications with CER1 and BMPR1A
 BMPR1B antibody  >1 publications with CER1 and BMPR1B
 BMPR2 antibody  >1 publications with CER1 and BMPR2

Pathways associated with anti-CER1 antibody

 Products by Pathway  Pathway Diagram
 BMP Receptor Signaling Pathway antibodies  BMP Receptor Signaling Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Endoderm Differentiation Pathway antibodies  Endoderm Differentiation Pathway Diagram
 Regulation Of Signaling By NODAL Pathway antibodies  Regulation Of Signaling By NODAL Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By BMP Pathway antibodies  Signaling By BMP Pathway Diagram
 Signaling By NODAL Pathway antibodies  Signaling By NODAL Pathway Diagram
 Wnt Signaling Pathway antibodies  Wnt Signaling Pathway Diagram
 Wnt Signaling Pathway antibodies  Wnt Signaling Pathway Diagram

Diseases associated with anti-CER1 antibody

 Disease Name  Pubmed Publications
 Disease Models, Animal Antibodies  >3 publications with CER1 and Disease Models, Animal
 Neoplasms, Experimental Antibodies  >3 publications with CER1 and Neoplasms, Experimental
 Heart Defects, Congenital Antibodies  >2 publications with CER1 and Heart Defects, Congenital
 Heart Diseases Antibodies  >2 publications with CER1 and Heart Diseases
 Abnormalities, Multiple Antibodies  >2 publications with CER1 and Abnormalities, Multiple
 Neurologic Manifestations Antibodies  >2 publications with CER1 and Neurologic Manifestations
 Kidney Diseases Antibodies  >2 publications with CER1 and Kidney Diseases
 Lung Diseases Antibodies  >1 publications with CER1 and Lung Diseases
 Weight Loss Antibodies  >1 publications with CER1 and Weight Loss
 Fatty Liver Antibodies  >1 publications with CER1 and Fatty Liver

Organs/Tissues associated with anti-CER1 antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >21 publications with CER1 and Embryonic Tissue
 Uncharacterized Tissue Antibodies  >1 publications with CER1 and Uncharacterized Tissue
 Pancreas Antibodies  >1 publications with CER1 and Pancreas
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000