Mouse Anti-CETN2 Monoclonal Antibody – Cat# MBS6200090

CETN2 Antibody – Mouse Monoclonal

Name: CETN2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200090
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200090

Plays a fundamental role in microtubule-organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CEP110. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CETN2, Monoclonal Antibody

Full Product Name

CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2) (MaxLight 490)

Product Gene Name

anti-CETN2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

3F8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CETN2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

21.9 kDa (192aa), confirmed by MALDI-TOF

OMIM

300006

3D Structure

ModBase 3D Structure for P41208

Immunogen

Partial recombinant corresponding to aa85-172 from human CETN2 (NP_004335) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Conjugate

MaxLight490

Product Categories/Family for anti-CETN2 antibody

Antibodies; Nuclear Proteins

Applications Tested/Suitable for anti-CETN2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-CETN2 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-CETN2 antibody

1. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. Barr AR, Kilmartin JV, Gergely F.J Cell Biol. 2010 Apr 5;189(1):23-39.

Other Notes

Small volumes of anti-CETN2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CETN2 purchase

MBS6200090 is an antibody targeting CETN2. Also known as CETN2 (Centrin-2, Caltractin Isoform 1, CALT, CEN2) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CETN2. It may not necessarily be applicable to this product.

NCBI GI #

4757902

NCBI GeneID

1069

NCBI Accession #

NP_004335

UniProt Primary Accession #

P41208

UniProt Secondary Accession #

Q53XW1; B2R4T4

UniProt Related Accession #

P41208

GenBank Nucleotide #

NM_004344

NCBI Official Full Name

centrin-2

NCBI Official Synonym Full Names

centrin 2

NCBI Official Symbol

CETN2

NCBI Official Synonym Symbols

CALT; CEN2

UniProt Protein Name

Centrin-2

UniProt Synonym Protein Names

Caltractin isoform 1

Protein Family

Centrin

UniProt Gene Name

CETN2

UniProt Synonym Gene Names

CALT; CEN2

UniProt Entry Name

CETN2_HUMAN

NCBI Protein Information

centrin-2

NCBI Summary for CETN2

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008]

UniProt Comments for CETN2

CETN2: a calcium-binding proteins and is a structural component of the centrosome. Contains 4 EF-hand calcium-binding domains. Highly conserved from algae to humans. Its association with the centrosome suggests that it plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Protein type: Calcium-binding; Cell cycle regulation; DNA repair, damage

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: centriole; centrosome; intracellular; cytosol; photoreceptor connecting cilium

Molecular Function: protein binding; microtubule binding; G-protein beta/gamma-subunit binding; calcium ion binding; heterotrimeric G-protein binding

Biological Process: mitosis; cell division; nucleotide-excision repair; organelle organization and biogenesis; centriole replication; spermatogenesis; mitotic cell cycle; G2/M transition of mitotic cell cycle; regulation of cytokinesis

Research Articles on CETN2

1. Multidisciplinary approach showed that HsPrp40Ap interacts with centrin in vitro, supporting a coupled functional role for these proteins in pre-mRNA splicing.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CETN2 antibody

Reference Product	PubMed Publications
XPC antibody	>22 publications with CETN2 and XPC
RAD23B antibody	>5 publications with CETN2 and RAD23B
PLK4 antibody	>2 publications with CETN2 and PLK4
SFI1 antibody	>2 publications with CETN2 and SFI1
USP44 antibody	>1 publications with CETN2 and USP44
PCNT antibody	>1 publications with CETN2 and PCNT

Pathways associated with anti-CETN2 antibody

Products by Pathway	Pathway Diagram
AURKA Activation By TPX2 Pathway antibodies	AURKA Activation By TPX2 Pathway Diagram
Anchoring Of The Basal Body To The Plasma Membrane Pathway antibodies	Anchoring Of The Basal Body To The Plasma Membrane Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
Cell Cycle, Mitotic Pathway antibodies	Cell Cycle, Mitotic Pathway Diagram
Centrosome Maturation Pathway antibodies	Centrosome Maturation Pathway Diagram
Cilium Assembly Pathway antibodies	Cilium Assembly Pathway Diagram
DNA Damage Recognition In GG-NER Pathway antibodies	DNA Damage Recognition In GG-NER Pathway Diagram
DNA Repair Pathway antibodies	DNA Repair Pathway Diagram
Formation Of Incision Complex In GG-NER Pathway antibodies	Formation Of Incision Complex In GG-NER Pathway Diagram
G2/M Transition Pathway antibodies	G2/M Transition Pathway Diagram

Diseases associated with anti-CETN2 antibody

Disease Name	Pubmed Publications
Congenital Abnormalities Antibodies	>6 publications with CETN2 and Congenital Abnormalities
Precancerous Conditions Antibodies	>5 publications with CETN2 and Precancerous Conditions
Lung Diseases Antibodies	>1 publications with CETN2 and Lung Diseases
Nervous System Diseases Antibodies	>1 publications with CETN2 and Nervous System Diseases
Disease Models, Animal Antibodies	>1 publications with CETN2 and Disease Models, Animal
Death Antibodies	>1 publications with CETN2 and Death
Immune System Diseases Antibodies	>1 publications with CETN2 and Immune System Diseases
Adenocarcinoma Antibodies	>1 publications with CETN2 and Adenocarcinoma
Breast Neoplasms Antibodies	>1 publications with CETN2 and Breast Neoplasms
Brain Diseases Antibodies	>1 publications with CETN2 and Brain Diseases

Organs/Tissues associated with anti-CETN2 antibody

Organ/Tissue Name	Pubmed Publications
Eye Antibodies	>3 publications with CETN2 and Eye
Testis Antibodies	>2 publications with CETN2 and Testis
Brain Antibodies	>2 publications with CETN2 and Brain
Ovary Antibodies	>1 publications with CETN2 and Ovary
Prostate Antibodies	>1 publications with CETN2 and Prostate
Pancreas Antibodies	>1 publications with CETN2 and Pancreas
Kidney Antibodies	>1 publications with CETN2 and Kidney
Lung Antibodies	>1 publications with CETN2 and Lung