Mouse Anti-COPB Monoclonal Antibody – Cat# MBS6200242

COPB Antibody – Mouse Monoclonal

Name: COPB Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200242
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200242

The Golgi complex is a key organelle where processing and sorting of newly synthesized proteins occurs. Membrane traffic from the endoplasmic reticulum (ER) to the Golgi complex and from the Golgi complex to the different final cellular destinations is… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

COPB, Monoclonal Antibody

Full Product Name

COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (MaxLight 490)

Product Gene Name

anti-COPB antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

3E10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human COPB.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

107kDa

OMIM

600959

3D Structure

ModBase 3D Structure for P53618

Immunogen

Partial recombinant corresponding to aa854-953 from human COPB (NP_057535) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI

Conjugate

MaxLight490

Product Categories/Family for anti-COPB antibody

Antibodies; Signal Transduction

Applications Tested/Suitable for anti-COPB antibody

FLISA

Application Notes for anti-COPB antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-COPB antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for COPB purchase

MBS6200242 is an antibody targeting COPB. Also known as COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for COPB. It may not necessarily be applicable to this product.

NCBI GI #

7705369

NCBI GeneID

1315

NCBI Accession #

NP_057535

UniProt Primary Accession #

P53618

UniProt Related Accession #

P53618

GenBank Nucleotide #

NM_016451

NCBI Official Full Name

coatomer subunit beta

NCBI Official Synonym Full Names

coatomer protein complex subunit beta 1

NCBI Official Symbol

COPB1

NCBI Official Synonym Symbols

COPB

UniProt Protein Name

Coatomer subunit beta

UniProt Synonym Protein Names

Beta-coat protein; Beta-COP

Protein Family

Copper-exporting P-type ATPase

UniProt Gene Name

COPB1

UniProt Synonym Gene Names

COPB; Beta-COP

UniProt Entry Name

COPB_HUMAN

NCBI Protein Information

coatomer subunit beta

NCBI Summary for COPB

This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]

Research Articles on COPB

1. Endogenous ANO1 was associated with COPB1 in U251 glioblastoma cells, and silencing of COPB1 enhanced surface expression and whole-cell currents of ANO1 in these cells. Taken together, these data suggest that COPB1 negatively regulates ANO1 surface expression.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.