Mouse Anti-CRKL Monoclonal Antibody – Cat# MBS6200289

CRKL Antibody – Mouse Monoclonal

Name: CRKL Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200289
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200289

MBS6200289 is an antibody targeting CRKL. Also known as CRKL (Crk-like Protein) (MaxLight 490). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CRKL, Monoclonal Antibody

Full Product Name

CRKL (Crk-like Protein) (MaxLight 490)

Product Gene Name

anti-CRKL antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

4B5

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CRKL.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

35.9 kDa (323aa), confirmed by MALDI-TOF

OMIM

602007

3D Structure

ModBase 3D Structure for P46109

Immunogen

Partial recombinant corresponding to aa204-303 from human CRKL (NP_005198) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE

Conjugate

MaxLight490

Product Categories/Family for anti-CRKL antibody

Antibodies; Disease Markers

Applications Tested/Suitable for anti-CRKL antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-CRKL antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-CRKL antibody

1. PI3K Links NKG2D Signaling to a CrkL Pathway Involved in Natural Killer Cell Adhesion, Polarity, and Granule Secretion. Segovis CM, Schoon RA, Dick CJ, Nacusi LP, Leibson PJ, Billadeau DD.J Immunol. 2009 Jun 1;182(11):6933-42.

Other Notes

Small volumes of anti-CRKL antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CRKL. It may not necessarily be applicable to this product.

NCBI GI #

4885153

NCBI GeneID

1399

NCBI Accession #

NP_005198

UniProt Primary Accession #

P46109

UniProt Secondary Accession #

A8KA44; D3DX35

UniProt Related Accession #

P46109

GenBank Nucleotide #

NM_005207

NCBI Official Full Name

crk-like protein

NCBI Official Synonym Full Names

CRK like proto-oncogene, adaptor protein

NCBI Official Symbol

CRKL

UniProt Protein Name

Crk-like protein

Protein Family

Crk-like protein

UniProt Gene Name

CRKL

UniProt Entry Name

CRKL_HUMAN

NCBI Protein Information

crk-like protein

NCBI Summary for CRKL

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009]

UniProt Comments for CRKL

CRKL: an oncogenic adaptor protein with an SH2-SH3-SH3 domain structure. Plays a specific role in integrin-induced migration as a downstream mediator of Src. Activates the RAS and Jnk signaling pathways. Transforms fibroblasts in a RAS-dependent fashion. A substrate of BCR-ABL and plays a role in fibroblast transformation by BCR-ABL.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytosol; endosome

Molecular Function: protein binding; signal transducer activity; SH3/SH2 adaptor activity

Biological Process: anterior/posterior pattern formation; blood vessel development; organ morphogenesis; nerve growth factor receptor signaling pathway; activation of MAPKK activity; thymus development; heart development; Ras protein signal transduction; JNK cascade; parathyroid gland development

Research Articles on CRKL

1. We demonstrated that CRKL is a novel downstream effector of ALK signaling in non-small-cell lung cancer

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CRKL antibody

Reference Product	PubMed Publications
BCR antibody	>144 publications with CRKL and BCR
CRK antibody	>132 publications with CRKL and CRK
CBL antibody	>67 publications with CRKL and CBL
GRB2 antibody	>48 publications with CRKL and GRB2
CD34 antibody	>25 publications with CRKL and CD34
LYN antibody	>17 publications with CRKL and LYN
DAB1 antibody	>13 publications with CRKL and DAB1
SYK antibody	>11 publications with CRKL and SYK
BCAR1 antibody	>9 publications with CRKL and BCAR1
PXN antibody	>9 publications with CRKL and PXN

Pathways associated with anti-CRKL antibody

Products by Pathway	Pathway Diagram
B Cell Receptor Signaling Pathway antibodies	B Cell Receptor Signaling Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Chronic Myeloid Leukemia Pathway antibodies	Chronic Myeloid Leukemia Pathway Diagram
Chronic Myeloid Leukemia Pathway antibodies	Chronic Myeloid Leukemia Pathway Diagram
Cytokine Signaling In Immune System Pathway antibodies	Cytokine Signaling In Immune System Pathway Diagram
Downstream Signal Transduction Pathway antibodies	Downstream Signal Transduction Pathway Diagram
EGF/EGFR Signaling Pathway antibodies	EGF/EGFR Signaling Pathway Diagram

Diseases associated with anti-CRKL antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>142 publications with CRKL and Neoplasms
Leukemia, Myelogenous, Chronic, BCR-ABL Positive Antibodies	>83 publications with CRKL and Leukemia, Myelogenous, Chronic, BCR-ABL Positive
Heart Defects, Congenital Antibodies	>12 publications with CRKL and Heart Defects, Congenital
Disease Models, Animal Antibodies	>11 publications with CRKL and Disease Models, Animal
Leukemia, Myeloid, Acute Antibodies	>11 publications with CRKL and Leukemia, Myeloid, Acute
Craniofacial Abnormalities Antibodies	>10 publications with CRKL and Craniofacial Abnormalities
DiGeorge Syndrome Antibodies	>10 publications with CRKL and DiGeorge Syndrome
Neoplasms, Experimental Antibodies	>7 publications with CRKL and Neoplasms, Experimental
Breast Neoplasms Antibodies	>5 publications with CRKL and Breast Neoplasms
Inflammation Antibodies	>4 publications with CRKL and Inflammation

Organs/Tissues associated with anti-CRKL antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>100 publications with CRKL and Blood
Bone Antibodies	>20 publications with CRKL and Bone
Nerve Antibodies	>19 publications with CRKL and Nerve
Bone Marrow Antibodies	>18 publications with CRKL and Bone Marrow
Brain Antibodies	>15 publications with CRKL and Brain
Embryonic Tissue Antibodies	>12 publications with CRKL and Embryonic Tissue
Lung Antibodies	>11 publications with CRKL and Lung
Heart Antibodies	>7 publications with CRKL and Heart
Stomach Antibodies	>5 publications with CRKL and Stomach
Thymus Antibodies	>4 publications with CRKL and Thymus