Mouse Anti-CRMP1 Monoclonal Antibody – Cat# MBS6200292

CRMP1 Antibody – Mouse Monoclonal

Name: CRMP1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200292
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200292

Collapsin-response mediator proteins (CRMPs) are highly expressed in the developing brain where they play major roles in axonal outgrowth, neurite differentiation, and apoptosis. Their continued expression in areas of high synaptic remodeling such as the… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CRMP1, Monoclonal Antibody

Full Product Name

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 490)

Product Gene Name

anti-CRMP1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2B6

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CRMP1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

74,262 Da

OMIM

602462

3D Structure

ModBase 3D Structure for Q14194

Immunogen

Partial recombinant corresponding to aa221-310 from human CRMP1 (NP_001014809.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL

Conjugate

MaxLight490

Product Categories/Family for anti-CRMP1 antibody

Antibodies; Neuroscience

Applications Tested/Suitable for anti-CRMP1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-CRMP1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CRMP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CRMP1 purchase

MBS6200292 is an antibody targeting CRMP1. Also known as CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CRMP1. It may not necessarily be applicable to this product.

NCBI GI #

62422571

NCBI GeneID

1400

NCBI Accession #

NP_001014809.1

UniProt Primary Accession #

Q14194

UniProt Secondary Accession #

Q13024; Q4W5F1; Q96TC8; A0EJG6

UniProt Related Accession #

Q14194

GenBank Nucleotide #

NM_001014809

NCBI Official Full Name

dihydropyrimidinase-related protein 1 isoform 1

NCBI Official Synonym Full Names

collapsin response mediator protein 1

NCBI Official Symbol

CRMP1

NCBI Official Synonym Symbols

DRP1; DRP-1; CRMP-1; DPYSL1; ULIP-3

UniProt Protein Name

Dihydropyrimidinase-related protein 1

UniProt Synonym Protein Names

Collapsin response mediator protein 1; CRMP-1; Unc-33-like phosphoprotein 3; ULIP-3

Protein Family

Dihydropyrimidinase-related protein

UniProt Gene Name

CRMP1

UniProt Synonym Gene Names

DPYSL1; ULIP3; DRP-1; CRMP-1; ULIP-3

UniProt Entry Name

DPYL1_HUMAN

NCBI Protein Information

dihydropyrimidinase-related protein 1; dihydropyrimidinase-like 1; unc-33-like phosphoprotein 3

NCBI Summary for CRMP1

This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

UniProt Comments for CRMP1

CRMP-1: Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytoskeletal; Hydrolase

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: cell soma; cytoplasm; dendrite; microtubule organizing center; spindle; cytosol

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides; protein binding

Biological Process: axon guidance; nervous system development; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; pyrimidine base catabolic process

Research Articles on CRMP1

1. in pilocarpine-induced animal model of epilepsy, CRMP-1 dynamically decreased in a range of 2 months. Thus, our results indicate that CRMP-1 may be involved in the development of TLE

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CRMP1 antibody

Reference Product	PubMed Publications
SEMA3A antibody	>17 publications with CRMP1 and SEMA3A
CDK5 antibody	>7 publications with CRMP1 and CDK5
PLXNA1 antibody	>2 publications with CRMP1 and PLXNA1
FYN antibody	>2 publications with CRMP1 and FYN
CDK5R1 antibody	>1 publications with CRMP1 and CDK5R1
PLXNA4 antibody	>1 publications with CRMP1 and PLXNA4
PLXNA3 antibody	>1 publications with CRMP1 and PLXNA3
DPYSL2 antibody	>1 publications with CRMP1 and DPYSL2

Pathways associated with anti-CRMP1 antibody

Products by Pathway	Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
CRMPs In Sema3A Signaling Pathway antibodies	CRMPs In Sema3A Signaling Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Semaphorin Interactions Pathway antibodies	Semaphorin Interactions Pathway Diagram

Diseases associated with anti-CRMP1 antibody

Disease Name	Pubmed Publications
Neoplasm Metastasis Antibodies	>4 publications with CRMP1 and Neoplasm Metastasis
Inflammation Antibodies	>3 publications with CRMP1 and Inflammation
Disease Models, Animal Antibodies	>2 publications with CRMP1 and Disease Models, Animal
Necrosis Antibodies	>2 publications with CRMP1 and Necrosis
Movement Disorders Antibodies	>1 publications with CRMP1 and Movement Disorders
Nerve Degeneration Antibodies	>1 publications with CRMP1 and Nerve Degeneration
Congenital Abnormalities Antibodies	>1 publications with CRMP1 and Congenital Abnormalities
Carcinoma, Hepatocellular Antibodies	>1 publications with CRMP1 and Carcinoma, Hepatocellular
Liver Neoplasms Antibodies	>1 publications with CRMP1 and Liver Neoplasms
Seizures Antibodies	>1 publications with CRMP1 and Seizures

Organs/Tissues associated with anti-CRMP1 antibody

Organ/Tissue Name	Pubmed Publications
Nerve Antibodies	>51 publications with CRMP1 and Nerve
Brain Antibodies	>24 publications with CRMP1 and Brain
Lung Antibodies	>10 publications with CRMP1 and Lung
Embryonic Tissue Antibodies	>8 publications with CRMP1 and Embryonic Tissue
Muscle Antibodies	>6 publications with CRMP1 and Muscle
Heart Antibodies	>1 publications with CRMP1 and Heart
Intestine Antibodies	>1 publications with CRMP1 and Intestine
Testis Antibodies	>1 publications with CRMP1 and Testis
Uncharacterized Tissue Antibodies	>1 publications with CRMP1 and Uncharacterized Tissue
Eye Antibodies	>1 publications with CRMP1 and Eye