• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CYP2J2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200379

CYP2J2 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CYP2J2, Monoclonal Antibody
Full Product Name
CYP2J2 (Cytochrome P450 2J2, CYPIIJ2, Arachidonic Acid Epoxygenase) (MaxLight 490)
Product Gene Name
anti-CYP2J2 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CYP2J2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
57,611 Da
OMIM
601258
3D Structure
ModBase 3D Structure for P51589
Immunogen
Partial recombinant corresponding to aa408-498 from human CYP2J2 (NP_000766) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Conjugate
MaxLight490

Product Categories/Family for anti-CYP2J2 antibody

Antibodies; Cytochrome
Applications Tested/Suitable for anti-CYP2J2 antibody
FLISA, Western Blot (WB)
Application Notes for anti-CYP2J2 antibody
Applications are based on unconjugated antibody.

Product References and Citations for anti-CYP2J2 antibody

1. Identifying a Selective Substrate and Inhibitor Pair for the Evaluation of CYP2J2 Activity. Lee CA, Jones JP 3rd, Katayama J, Kaspera R, Jiang Y, Freiwald S, Smith E, Walker GS, Totah RA.Drug Metab Dispos. 2012 May;40(5):943-51. Epub 2012 Feb 10. 2. Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function. Pearson T, Warren AY, Barrett DA, Khan RN.Am J Physiol Endocrinol Metab. 2009 Sep;297(3):E647-56. Epub 2009 Jun 23.

Other Notes

Small volumes of anti-CYP2J2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CYP2J2 purchase

MBS6200379 is an antibody targeting CYP2J2. Also known as CYP2J2 (Cytochrome P450 2J2, CYPIIJ2, Arachidonic Acid Epoxygenase) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CYP2J2. It may not necessarily be applicable to this product.

NCBI GI #
18491008
NCBI GeneID
1573
NCBI Accession #
NP_000766
UniProt Primary Accession #
P51589
UniProt Secondary Accession #
Q8TF13; B2RD33
UniProt Related Accession #
P51589
GenBank Nucleotide #
NM_000775
NCBI Official Full Name
cytochrome P450 2J2
NCBI Official Synonym Full Names
cytochrome P450, family 2, subfamily J, polypeptide 2
NCBI Official Symbol
CYP2J2
NCBI Official Synonym Symbols
CPJ2
UniProt Protein Name
Cytochrome P450 2J2
UniProt Synonym Protein Names
Arachidonic acid epoxygenase; CYPIIJ2
Protein Family
Cytochrome
UniProt Gene Name
CYP2J2
UniProt Entry Name
CP2J2_HUMAN
NCBI Protein Information
cytochrome P450 2J2; CYPIIJ2; arachidonic acid epoxygenase; cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2; flavoprotein-linked monooxygenase; microsomal monooxygenase

UniProt Comments for CYP2J2

CYP2J2: This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Lipid Metabolism - arachidonic acid; Contractile; Lipid Metabolism - linoleic acid; EC 1.14.14.1

Chromosomal Location of Human Ortholog: 1p31.3-p31.2

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; cytoplasm

Molecular Function: arachidonic acid 14,15-epoxygenase activity; iron ion binding; arachidonic acid 11,12-epoxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; heme binding; arachidonic acid epoxygenase activity; steroid hydroxylase activity; oxygen binding

Biological Process: xenobiotic metabolic process; icosanoid metabolic process; exogenous drug catabolic process; arachidonic acid metabolic process; linoleic acid metabolic process; epoxygenase P450 pathway; regulation of heart contraction
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CYP2J2 antibody

 Products by Pathway  Pathway Diagram
 Arachidonate Epoxygenase / Epoxide Hydrolase Pathway antibodies  Arachidonate Epoxygenase / Epoxide Hydrolase Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Biological Oxidations Pathway antibodies  Biological Oxidations Pathway Diagram
 Cytochrome P450 - Arranged By Substrate Type Pathway antibodies  Cytochrome P450 - Arranged By Substrate Type Pathway Diagram
 Defective CYP11A1 Causes Adrenal Insufficiency, Congenital, With 46,XY Sex Reversal (AICSR) Pathway antibodies  Defective CYP11A1 Causes Adrenal Insufficiency, Congenital, With 46,XY Sex Reversal (AICSR) Pathway Diagram
 Defective CYP11B1 Causes Adrenal Hyperplasia 4 (AH4) Pathway antibodies  Defective CYP11B1 Causes Adrenal Hyperplasia 4 (AH4) Pathway Diagram
 Defective CYP11B2 Causes Corticosterone Methyloxidase 1 Deficiency (CMO-1 Deficiency) Pathway antibodies  Defective CYP11B2 Causes Corticosterone Methyloxidase 1 Deficiency (CMO-1 Deficiency) Pathway Diagram
 Defective CYP17A1 Causes Adrenal Hyperplasia 5 (AH5) Pathway antibodies  Defective CYP17A1 Causes Adrenal Hyperplasia 5 (AH5) Pathway Diagram

Diseases associated with anti-CYP2J2 antibody

 Disease Name  Pubmed Publications
 Cardiovascular Diseases Antibodies  >40 publications with CYP2J2 and Cardiovascular Diseases
 Inflammation Antibodies  >21 publications with CYP2J2 and Inflammation
 Neoplasms Antibodies  >15 publications with CYP2J2 and Neoplasms
 Drug Toxicity Antibodies  >8 publications with CYP2J2 and Drug Toxicity
 Kidney Diseases Antibodies  >6 publications with CYP2J2 and Kidney Diseases
 Fatty Liver Antibodies  >5 publications with CYP2J2 and Fatty Liver
 Atherosclerosis Antibodies  >5 publications with CYP2J2 and Atherosclerosis
 Lung Neoplasms Antibodies  >5 publications with CYP2J2 and Lung Neoplasms
 Necrosis Antibodies  >5 publications with CYP2J2 and Necrosis
 Brain Diseases Antibodies  >4 publications with CYP2J2 and Brain Diseases

Organs/Tissues associated with anti-CYP2J2 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >47 publications with CYP2J2 and Liver
 Heart Antibodies  >39 publications with CYP2J2 and Heart
 Muscle Antibodies  >27 publications with CYP2J2 and Muscle
 Kidney Antibodies  >22 publications with CYP2J2 and Kidney
 Intestine Antibodies  >19 publications with CYP2J2 and Intestine
 Lung Antibodies  >14 publications with CYP2J2 and Lung
 Brain Antibodies  >5 publications with CYP2J2 and Brain
 Bone Antibodies  >4 publications with CYP2J2 and Bone
 Testis Antibodies  >2 publications with CYP2J2 and Testis
 Placenta Antibodies  >2 publications with CYP2J2 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000