Mouse Anti-DENR Monoclonal Antibody – Cat# MBS6200446

DENR Antibody – Mouse Monoclonal

Name: DENR Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200446
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200446

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DENR, Monoclonal Antibody

Full Product Name

DENR (Density-regulated Protein, DRP, Protein DRP1, Smooth Muscle Cell-associated Protein 3, SMAP-3, DRP1, H14) (MaxLight 490)

Product Gene Name

anti-DENR antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1H3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human DENR.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

Predicted: 22 kDa

Observed: 22 kDa

OMIM

604550

3D Structure

ModBase 3D Structure for O43583

Immunogen

Partial recombinant corresponding to aa1-82 from DENR (NP_003668) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS*

Conjugate

MaxLight490

Product Categories/Family for anti-DENR antibody

Antibodies; DNA/RNA Translation

Applications Tested/Suitable for anti-DENR antibody

FLISA, Western Blot (WB)

Application Notes for anti-DENR antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DENR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DENR purchase

MBS6200446 is an antibody targeting DENR. Also known as DENR (Density-regulated Protein, DRP, Protein DRP1, Smooth Muscle Cell-associated Protein 3, SMAP-3, DRP1, H14) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DENR. It may not necessarily be applicable to this product.

NCBI GI #

27501446

NCBI GeneID

8562

NCBI Accession #

NP_003668

UniProt Primary Accession #

O43583

UniProt Secondary Accession #

Q9H3U6; Q9UKZ0

UniProt Related Accession #

O43583

GenBank Nucleotide #

NM_003677

NCBI Official Full Name

density-regulated protein

NCBI Official Synonym Full Names

density-regulated protein

NCBI Official Symbol

DENR

NCBI Official Synonym Symbols

DRP; DRP1; SMAP-3

UniProt Protein Name

Density-regulated protein

UniProt Synonym Protein Names

Protein DRP1; Smooth muscle cell-associated protein 3; SMAP-3

Protein Family

Density-regulated protein

UniProt Gene Name

DENR

UniProt Synonym Gene Names

DRP1; DRP; SMAP-3

UniProt Entry Name

DENR_HUMAN

NCBI Protein Information

density-regulated protein; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3

NCBI Summary for DENR

This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008]

UniProt Comments for DENR

DENR: May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Plays a role in the modulation of the translational profile of a subset of cancer- related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1. Belongs to the DENR family.

Protein type: RNA-binding; Translation

Chromosomal Location of Human Ortholog: 12q24.31

Molecular Function: protein binding; translation initiation factor activity

Biological Process: ribosome disassembly; formation of translation preinitiation complex

Research Articles on DENR

1. both HuR and AUF1 bind to discrete regions of DENR/DRP mRNA and that AUF1 silencing increases DENR/DRP protein levels.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DENR antibody

Reference Product	PubMed Publications
MCTS1 antibody	>4 publications with DENR and MCTS1

Diseases associated with anti-DENR antibody

Disease Name	Pubmed Publications
Hepatitis Antibodies	>1 publications with DENR and Hepatitis
Neoplasm Metastasis Antibodies	>1 publications with DENR and Neoplasm Metastasis

Organs/Tissues associated with anti-DENR antibody

Organ/Tissue Name	Pubmed Publications
Nerve Antibodies	>1 publications with DENR and Nerve
Muscle Antibodies	>1 publications with DENR and Muscle
Embryonic Tissue Antibodies	>1 publications with DENR and Embryonic Tissue