Mouse Anti-EIF2D Monoclonal Antibody – Cat# MBS6200619

EIF2D Antibody – Mouse Monoclonal

Name: EIF2D Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200619
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200619

Trafficking receptor for phosphoglycoproteins. Localizes phosphoglycoproteins within endosomes and at the cell periphery where they participate in specific metabolic processes as well as intercellular adhesion. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

EIF2D, Monoclonal Antibody

Full Product Name

EIF2D (Eukaryotic Translation Initiation Factor 2D, eIF2d, Hepatocellular Carcinoma-associated Antigen 56, Ligatin, HCA56, LGTN) (MaxLight 490)

Product Gene Name

anti-EIF2D antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2D10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human EIF2D.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

613709

3D Structure

ModBase 3D Structure for P41214

Immunogen

Partial recombinant corresponding to aa485-584 from human EIF2D (NP_008824.2) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

Conjugate

MaxLight490

Product Categories/Family for anti-EIF2D antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-EIF2D antibody

FLISA, Western Blot (WB)

Application Notes for anti-EIF2D antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-EIF2D antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for EIF2D purchase

MBS6200619 is an antibody targeting EIF2D. Also known as EIF2D (Eukaryotic Translation Initiation Factor 2D, eIF2d, Hepatocellular Carcinoma-associated Antigen 56, Ligatin, HCA56, LGTN) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for EIF2D. It may not necessarily be applicable to this product.

NCBI GI #

56699485

NCBI Accession #

NP_008824.2

UniProt Primary Accession #

P41214

GenBank Nucleotide #

NM_006893

NCBI Official Full Name

eukaryotic translation initiation factor 2D isoform 1

UniProt Protein Name

Eukaryotic translation initiation factor 2D

UniProt Synonym Protein Names

Hepatocellular carcinoma-associated antigen 56; Ligatin

Protein Family

Eukaryotic translation initiation factor

UniProt Gene Name

EIF2D

UniProt Synonym Gene Names

HCA56; LGTN; eIF2d

UniProt Entry Name

EIF2D_HUMAN

UniProt Comments for EIF2D

Ligatin: Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P- site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Belongs to the eIF2D family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: translation initiation factor activity; receptor activity

Biological Process: intracellular protein transport; ribosome disassembly; formation of translation preinitiation complex

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.