Mouse Anti-ESD Monoclonal Antibody – Cat# MBS6200710

ESD Antibody – Mouse Monoclonal

Name: ESD Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200710
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200710

ESD belongs to the esterase D family. This protein is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ESD, Monoclonal Antibody

Full Product Name

ESD (S-formylglutathione Hydrolase, FGH, Esterase D) (MaxLight 490)

Product Gene Name

anti-ESD antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1E1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ESD.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

31,463 Da

OMIM

133280

3D Structure

ModBase 3D Structure for P10768

Immunogen

Partial recombinant corresponding to aa183-281 from human ESD (NP_001975.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN

Conjugate

MaxLight490

Product Categories/Family for anti-ESD antibody

Antibodies; Enzymes

Applications Tested/Suitable for anti-ESD antibody

FLISA, Western Blot (WB)

Application Notes for anti-ESD antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ESD antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ESD purchase

MBS6200710 is an antibody targeting ESD. Also known as ESD (S-formylglutathione Hydrolase, FGH, Esterase D) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ESD. It may not necessarily be applicable to this product.

NCBI GI #

33413400

NCBI GeneID

2098

NCBI Accession #

NP_001975.1

UniProt Primary Accession #

P10768

UniProt Secondary Accession #

Q5TBU8; Q5TBV0; Q5TBV2; Q9BVJ2

UniProt Related Accession #

P10768

GenBank Nucleotide #

NM_001984

NCBI Official Full Name

S-formylglutathione hydrolase

NCBI Official Synonym Full Names

esterase D

NCBI Official Symbol

ESD

NCBI Official Synonym Symbols

FGH

UniProt Protein Name

S-formylglutathione hydrolase

UniProt Synonym Protein Names

Esterase D; Methylumbelliferyl-acetate deacetylase (EC:3.1.1.56)

UniProt Gene Name

ESD

UniProt Synonym Gene Names

FGH

UniProt Entry Name

ESTD_HUMAN

NCBI Protein Information

S-formylglutathione hydrolase; esterase 10; esterase D/formylglutathione hydrolase; methylumbelliferyl-acetate deacetylase

NCBI Summary for ESD

This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009]

UniProt Comments for ESD

esterase D: an enzyme that catalyzes the conversion of carboxylic esters and H2O into alcohol and a carboxylic anion.

Protein type: EC 3.1.2.12; EC 3.1.1.56; Hydrolase

Chromosomal Location of Human Ortholog: 13q14.1-q14.2

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasmic membrane-bound vesicle; cytoplasm; plasma membrane

Molecular Function: S-formylglutathione hydrolase activity; methylumbelliferyl-acetate deacetylase activity; hydrolase activity, acting on ester bonds

Biological Process: formaldehyde catabolic process

Research Articles on ESD

1. Abhydrolase domain-containing protein 11 and Esterase D predict the development of distant metastases and the presence of aggressive lung adenocarcinomas.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ESD antibody

Reference Product	PubMed Publications
HAGH antibody	>1 publications with ESD and HAGH

Pathways associated with anti-ESD antibody

Products by Pathway	Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Phase I, Non P450 Pathway antibodies	Phase I, Non P450 Pathway Diagram
Formaldehyde Oxidation Pathway antibodies	Formaldehyde Oxidation Pathway Diagram

Diseases associated with anti-ESD antibody

Disease Name	Pubmed Publications
Hemorrhage Antibodies	>130 publications with ESD and Hemorrhage
Heart Diseases Antibodies	>102 publications with ESD and Heart Diseases
Nervous System Diseases Antibodies	>72 publications with ESD and Nervous System Diseases
Fibrosis Antibodies	>64 publications with ESD and Fibrosis
Brain Diseases Antibodies	>52 publications with ESD and Brain Diseases
Disease Models, Animal Antibodies	>38 publications with ESD and Disease Models, Animal
Liver Neoplasms Antibodies	>37 publications with ESD and Liver Neoplasms
Precancerous Conditions Antibodies	>32 publications with ESD and Precancerous Conditions
Inflammation Antibodies	>31 publications with ESD and Inflammation
Lung Diseases Antibodies	>29 publications with ESD and Lung Diseases

Organs/Tissues associated with anti-ESD antibody

Organ/Tissue Name	Pubmed Publications
Stomach Antibodies	>604 publications with ESD and Stomach
Blood Antibodies	>528 publications with ESD and Blood
Intestine Antibodies	>236 publications with ESD and Intestine
Lymph Antibodies	>161 publications with ESD and Lymph
Lymph Node Antibodies	>158 publications with ESD and Lymph Node
Heart Antibodies	>125 publications with ESD and Heart
Skin Antibodies	>110 publications with ESD and Skin
Liver Antibodies	>78 publications with ESD and Liver
Eye Antibodies	>77 publications with ESD and Eye
Vascular Antibodies	>76 publications with ESD and Vascular