Mouse Anti-HKDC1 Monoclonal Antibody – Cat# MBS6201222

HKDC1 Antibody – Mouse Monoclonal

Name: HKDC1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6201222
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6201222

MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HKDC1, Monoclonal Antibody

Full Product Name

HKDC1 (Putative Hexokinase HKDC1, Hexokinase Domain-containing Protein 1, FLJ22761, FLJ37767, MGC125688) (MaxLight 490)

Product Gene Name

anti-HKDC1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4E8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human HKDC1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

102kDa

3D Structure

ModBase 3D Structure for Q2TB90

Immunogen

Partial recombinant corresponding to aa102-201 from human HKDC1 (NP_079406) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KRHVQMESQFYPTPNEIIRGNGIELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMD

Conjugate

MaxLight490

Product Categories/Family for anti-HKDC1 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-HKDC1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-HKDC1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HKDC1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HKDC1 purchase

MBS6201222 is an antibody targeting HKDC1. Also known as HKDC1 (Putative Hexokinase HKDC1, Hexokinase Domain-containing Protein 1, FLJ22761, FLJ37767, MGC125688) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HKDC1. It may not necessarily be applicable to this product.

NCBI GI #

1519312078

NCBI GeneID

80201

NCBI Accession #

NP_079406

UniProt Primary Accession #

Q2TB90

UniProt Related Accession #

Q2TB90

GenBank Nucleotide #

NM_025130

NCBI Official Full Name

putative hexokinase HKDC1

NCBI Official Synonym Full Names

hexokinase domain containing 1

NCBI Official Symbol

HKDC1

UniProt Protein Name

Putative hexokinase HKDC1

UniProt Synonym Protein Names

Hexokinase domain-containing protein 1

Protein Family

Putative hexokinase

UniProt Gene Name

HKDC1

UniProt Entry Name

HKDC1_HUMAN

NCBI Protein Information

putative hexokinase HKDC1

NCBI Summary for HKDC1

This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma. [provided by RefSeq, Sep 2016]

UniProt Comments for HKDC1

HKDC1: Belongs to the hexokinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.1; Kinase, other

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: cytosol

Molecular Function: ATP binding; fructokinase activity; glucokinase activity; glucose binding; mannokinase activity

Biological Process: carbohydrate phosphorylation; cell glucose homeostasis; glucose 6-phosphate metabolic process; glycolysis; hexose metabolic process

Research Articles on HKDC1

1. results suggest a conditional regulation of KRT16 gene by ATF4 that may be inhibited in normal cells, but engaged during cancer progression. Potential roles of KRT16, FAM129A and HKDC1 genes upregulation in adaptive stress responses and pathologies are discussed

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.