Mouse Anti-RIN2 Monoclonal Antibody – Cat# MBS6202968

RIN2 Antibody – Mouse Monoclonal

Name: RIN2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6202968
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6202968

MBS6202968 is an antibody targeting RIN2. Also known as RIN2 (Ras and Rab Interactor 2, MACS, Ras Association Domain Family 4, RASSF4, Ras Inhibitor JC265, Ras Interaction/interference Protein 2) (MaxLight 490). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RIN2, Monoclonal Antibody

Full Product Name

RIN2 (Ras and Rab Interactor 2, MACS, Ras Association Domain Family 4, RASSF4, Ras Inhibitor JC265, Ras Interaction/interference Protein 2) (MaxLight 490)

Product Gene Name

anti-RIN2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1E7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RIN2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

610222

3D Structure

ModBase 3D Structure for Q8WYP3

Immunogen

Partial recombinant corresponding to aa786-895 from human RIN2 (NP_061866) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT

Conjugate

MaxLight490

Product Categories/Family for anti-RIN2 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

Applications Tested/Suitable for anti-RIN2 antibody

FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)

Application Notes for anti-RIN2 antibody

IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RIN2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RIN2. It may not necessarily be applicable to this product.

NCBI GI #

18466802

NCBI GeneID

54453

NCBI Accession #

NP_061866

UniProt Primary Accession #

Q8WYP3

UniProt Related Accession #

Q8WYP3

GenBank Nucleotide #

NM_018993

NCBI Official Full Name

ras and Rab interactor 2 isoform 2

NCBI Official Synonym Full Names

Ras and Rab interactor 2

NCBI Official Symbol

RIN2

NCBI Official Synonym Symbols

MACS; RASSF4

UniProt Protein Name

Ras and Rab interactor 2

UniProt Synonym Protein Names

Ras association domain family 4; Ras inhibitor JC265; Ras interaction/interference protein 2

Protein Family

E3 ubiquitin protein ligase

UniProt Gene Name

RIN2

UniProt Synonym Gene Names

RASSF4

UniProt Entry Name

RIN2_HUMAN

NCBI Protein Information

ras and Rab interactor 2

NCBI Summary for RIN2

The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family. Mutations in this gene cause macrocephaly alopecia cutis laxa and scoliosis (MACS) syndrome, an elastic tissue disorder, as well as the related connective tissue disorder, RIN2 syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011]

Research Articles on RIN2

1. Rab5 as a novel regulator of calpain2 activity and focal adhesion proteolysis leading to cell migration

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.