Mouse Anti-CTNNB1 Monoclonal Antibody – Cat# MBS6205787

CTNNB1 Antibody – Mouse Monoclonal

Name: CTNNB1 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6205787
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6205787

Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells,… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CTNNB1, Monoclonal Antibody

Full Product Name

CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (MaxLight 490)

Product Gene Name

anti-CTNNB1 antibody

Product Synonym Names

Catenin (Cadherin-Associated Protein); beta 1; 88kD; CTNNB; DKFZp686D02253; FLJ25606; FLJ37923

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

4F2

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes CTNNB1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

CTNNB1 (AAH58926, 682aa-781aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Conjugate

MaxLight490

Product Categories/Family for anti-CTNNB1 antibody

Antibodies; Catenin

Applications Tested/Suitable for anti-CTNNB1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-CTNNB1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CTNNB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CTNNB1 purchase

MBS6205787 is an antibody targeting CTNNB1. Also known as CTNNB1 (Catenin (Cadherin-Associated Protein), beta 1, 88kD, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923) (MaxLight 490). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CTNNB1. It may not necessarily be applicable to this product.

NCBI GI #

37590638

NCBI GeneID

1499

NCBI Accession #

AAH58926

UniProt Related Accession #

P35222

NCBI Official Full Name

Catenin (cadherin-associated protein), beta 1, 88kDa

NCBI Official Synonym Full Names

catenin beta 1

NCBI Official Symbol

CTNNB1

NCBI Official Synonym Symbols

EVR7; CTNNB; MRD19; NEDSDV; armadillo

Protein Family

Catenin

NCBI Protein Information

catenin beta-1

NCBI Summary for CTNNB1

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]

Research Articles on CTNNB1

1. Detailed cell fractionation, immunoprecipitation, microscopy, and immunohistochemical analyses demonstrated that CDCP1 promotes translocation of the key regulators of Wnt signaling, b-catenin, and E-cadherin, to the nucleus. Of functional importance, disruption of CDCP1 reduces nuclear localized, chromatin-associated b-catenin and nuclear localized E-cadherin, increases sequestration of these proteins in cell membranes

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.