Mouse Anti-HOXC4 Monoclonal Antibody – Cat# MBS6206729

HOXC4 Antibody – Mouse Monoclonal

Name: HOXC4 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6206729
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6206729

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HOXC4, Monoclonal Antibody

Full Product Name

HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (MaxLight 490)

Product Gene Name

anti-HOXC4 antibody

Product Synonym Names

Homeobox C4; HOX3; HOX3E; cp19

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2D6

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes HOXC4.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

29kDa

OMIM

142974

3D Structure

ModBase 3D Structure for P09017

Immunogen

HOXC4 (NP_705897, 160aa-264aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL

Conjugate

MaxLight490

Product Categories/Family for anti-HOXC4 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

Applications Tested/Suitable for anti-HOXC4 antibody

Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-HOXC4 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HOXC4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HOXC4 purchase

MBS6206729 is an antibody targeting HOXC4. Also known as HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (MaxLight 490). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HOXC4. It may not necessarily be applicable to this product.

NCBI GI #

24497540

NCBI GeneID

3221

NCBI Accession #

NP_705897

UniProt Primary Accession #

P09017

UniProt Related Accession #

P09017

GenBank Nucleotide #

NM_153633

NCBI Official Full Name

homeobox protein Hox-C4

NCBI Official Synonym Full Names

homeobox C4

NCBI Official Symbol

HOXC4

NCBI Official Synonym Symbols

HOX3; cp19; HOX3E

UniProt Protein Name

Homeobox protein Hox-C4

UniProt Synonym Protein Names

Homeobox protein CP19; Homeobox protein Hox-3E

Protein Family

Homeobox protein

UniProt Gene Name

HOXC4

UniProt Synonym Gene Names

HOX3E

UniProt Entry Name

HXC4_HUMAN

NCBI Protein Information

homeobox protein Hox-C4

UniProt Comments for HOXC4

HOXC4: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family. Deformed subfamily.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; cartilage development; embryonic organ morphogenesis; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on HOXC4

1. HOXC4 homeoprotein expands human hematopoietic immature cells by 3 to 6 times ex vivo and significantly improves the level of in vivo engraftment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HOXC4 antibody

Reference Product	PubMed Publications
XRCC5 antibody	>2 publications with HOXC4 and XRCC5
POU2F1 antibody	>2 publications with HOXC4 and POU2F1
PRKDC antibody	>1 publications with HOXC4 and PRKDC

Diseases associated with anti-HOXC4 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>12 publications with HOXC4 and Neoplasms
Skin Neoplasms Antibodies	>3 publications with HOXC4 and Skin Neoplasms
Carcinoma Antibodies	>2 publications with HOXC4 and Carcinoma
Congenital Abnormalities Antibodies	>2 publications with HOXC4 and Congenital Abnormalities
Heart Diseases Antibodies	>1 publications with HOXC4 and Heart Diseases
Nervous System Diseases Antibodies	>1 publications with HOXC4 and Nervous System Diseases
Cardiovascular Abnormalities Antibodies	>1 publications with HOXC4 and Cardiovascular Abnormalities
Heart Defects, Congenital Antibodies	>1 publications with HOXC4 and Heart Defects, Congenital
Inflammation Antibodies	>1 publications with HOXC4 and Inflammation
Necrosis Antibodies	>1 publications with HOXC4 and Necrosis

Organs/Tissues associated with anti-HOXC4 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>10 publications with HOXC4 and Bone
Embryonic Tissue Antibodies	>9 publications with HOXC4 and Embryonic Tissue
Skin Antibodies	>8 publications with HOXC4 and Skin
Lymph Node Antibodies	>5 publications with HOXC4 and Lymph Node
Connective Tissue Antibodies	>3 publications with HOXC4 and Connective Tissue
Brain Antibodies	>3 publications with HOXC4 and Brain
Heart Antibodies	>3 publications with HOXC4 and Heart
Muscle Antibodies	>2 publications with HOXC4 and Muscle
Stomach Antibodies	>2 publications with HOXC4 and Stomach
Lung Antibodies	>2 publications with HOXC4 and Lung