Mouse Anti-LMO2 Monoclonal Antibody – Cat# MBS6207193

LMO2 Antibody – Mouse Monoclonal

Name: LMO2 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6207193
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6207193

LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LMO2, Monoclonal Antibody

Full Product Name

LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2) (MaxLight 490)

Product Gene Name

anti-LMO2 antibody

Product Synonym Names

LIM Domain only 2 (rhombotin-like 1); RBTN2; RBTNL1; RHOM2; TTG2

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

4C6

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes LMO2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

24kDa

OMIM

180385

3D Structure

ModBase 3D Structure for P25791

Immunogen

LMO2 (NP_005565, 16aa-102aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR

Conjugate

MaxLight490

Product Categories/Family for anti-LMO2 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-LMO2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-LMO2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-LMO2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LMO2 purchase

MBS6207193 is an antibody targeting LMO2. Also known as LMO2 (LIM Domain only 2 (rhombotin-like 1), RBTN2, RBTNL1, RHOM2, TTG2) (MaxLight 490). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LMO2. It may not necessarily be applicable to this product.

NCBI GI #

214832074

NCBI GeneID

4005

NCBI Accession #

NP_005565

UniProt Primary Accession #

P25791

UniProt Related Accession #

P25791

GenBank Nucleotide #

NM_005574

NCBI Official Full Name

rhombotin-2 isoform 1

NCBI Official Synonym Full Names

LIM domain only 2

NCBI Official Symbol

LMO2

NCBI Official Synonym Symbols

TTG2; LMO-2; RBTN2; RHOM2; RBTNL1

UniProt Protein Name

Rhombotin-2

UniProt Synonym Protein Names

Cysteine-rich protein TTG-2; LIM domain only protein 2; LMO-2; T-cell translocation protein 2

Protein Family

Rhombotin

UniProt Gene Name

LMO2

UniProt Synonym Gene Names

RBTN2; RBTNL1; RHOM2; TTG2; LMO-2

UniProt Entry Name

RBTN2_HUMAN

NCBI Protein Information

rhombotin-2

UniProt Comments for LMO2

LMO2: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. A chromosomal aberration involving LMO2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p13;q11) with TCRD. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Oncoprotein

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: transcription factor complex; nucleus

Molecular Function: protein binding; zinc ion binding; bHLH transcription factor binding; chromatin binding; cofactor binding

Biological Process: negative regulation of erythrocyte differentiation; embryonic hemopoiesis; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; mRNA transcription from RNA polymerase II promoter

Research Articles on LMO2

1. the data in this study revealed a novel crosstalk between LMO2 and the Wnt signaling pathway during tumorigenesis and suggested that LMO2 might be a tumor suppressor in certain solid tumors.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-LMO2 antibody

Reference Product	PubMed Publications
TAL1 antibody	>119 publications with LMO2 and TAL1
LDB1 antibody	>60 publications with LMO2 and LDB1
GATA1 antibody	>58 publications with LMO2 and GATA1
GATA2 antibody	>40 publications with LMO2 and GATA2
BMP4 antibody	>4 publications with LMO2 and BMP4
RLIM antibody	>2 publications with LMO2 and RLIM
ELF2 antibody	>1 publications with LMO2 and ELF2
BEX1 antibody	>1 publications with LMO2 and BEX1
KDM5A antibody	>1 publications with LMO2 and KDM5A
BEX2 antibody	>1 publications with LMO2 and BEX2

Pathways associated with anti-LMO2 antibody

Products by Pathway	Pathway Diagram
Transcriptional Misregulation In Cancer Pathway antibodies	Transcriptional Misregulation In Cancer Pathway Diagram
Transcriptional Misregulation In Cancer Pathway antibodies	Transcriptional Misregulation In Cancer Pathway Diagram

Diseases associated with anti-LMO2 antibody

Disease Name	Pubmed Publications
Leukemia, T-Cell Antibodies	>120 publications with LMO2 and Leukemia, T-Cell
Lymphoma Antibodies	>117 publications with LMO2 and Lymphoma
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Antibodies	>32 publications with LMO2 and Precursor T-Cell Lymphoblastic Leukemia-Lymphoma
Cell Transformation, Neoplastic Antibodies	>21 publications with LMO2 and Cell Transformation, Neoplastic
Disease Models, Animal Antibodies	>19 publications with LMO2 and Disease Models, Animal
Neoplasms, Experimental Antibodies	>12 publications with LMO2 and Neoplasms, Experimental
Nervous System Diseases Antibodies	>7 publications with LMO2 and Nervous System Diseases
Kidney Diseases Antibodies	>5 publications with LMO2 and Kidney Diseases
Inflammation Antibodies	>4 publications with LMO2 and Inflammation
Prostatic Neoplasms Antibodies	>4 publications with LMO2 and Prostatic Neoplasms

Organs/Tissues associated with anti-LMO2 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>174 publications with LMO2 and Blood
Bone Antibodies	>53 publications with LMO2 and Bone
Vascular Antibodies	>45 publications with LMO2 and Vascular
Bone Marrow Antibodies	>40 publications with LMO2 and Bone Marrow
Embryonic Tissue Antibodies	>26 publications with LMO2 and Embryonic Tissue
Liver Antibodies	>22 publications with LMO2 and Liver
Kidney Antibodies	>16 publications with LMO2 and Kidney
Lymph Node Antibodies	>14 publications with LMO2 and Lymph Node
Heart Antibodies	>12 publications with LMO2 and Heart
Brain Antibodies	>10 publications with LMO2 and Brain