Mouse Anti-NME4 Monoclonal Antibody – Cat# MBS6207619

NME4 Antibody – Mouse Monoclonal

Name: NME4 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6207619
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6207619

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NME4, Monoclonal Antibody

Full Product Name

NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (MaxLight 490)

Product Gene Name

anti-NME4 antibody

Product Synonym Names

Non-Metastatic Cells 4; Protein Expressed in; NDPK-D; NM23H4; nm23-H4

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

4B6

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes NME4.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

20,659 Da

Chromosome Location

Chromosome: 16; NC_000016.9 (446752..450754). Location: 16p13.3

OMIM

601818

3D Structure

ModBase 3D Structure for O00746

Immunogen

NME4 (NP_005000.1, 99aa-187aa) partial recombinant protein with GST tag.

Immunogen Sequence

RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

Conjugate

MaxLight490

Product Categories/Family for anti-NME4 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-NME4 antibody

FLISA, Western Blot (WB)

Application Notes for anti-NME4 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NME4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NME4 purchase

MBS6207619 is an antibody targeting NME4. Also known as NME4 (Non-Metastatic Cells 4, Protein Expressed in, NDPK-D, NM23H4, nm23-H4) (MaxLight 490). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NME4. It may not necessarily be applicable to this product.

NCBI GI #

4826862

NCBI GeneID

4833

NCBI Accession #

NP_005000.1

UniProt Primary Accession #

O00746

UniProt Secondary Accession #

Q5U0M9

UniProt Related Accession #

O00746

GenBank Nucleotide #

NM_005009.2

NCBI Official Full Name

nucleoside diphosphate kinase, mitochondrial

NCBI Official Synonym Full Names

NME/NM23 nucleoside diphosphate kinase 4

NCBI Official Symbol

NME4

NCBI Official Synonym Symbols

NDPK-D; NM23H4; nm23-H4

UniProt Protein Name

Nucleoside diphosphate kinase, mitochondrial

UniProt Synonym Protein Names

Nucleoside diphosphate kinase D; NDPKD; nm23-H4

UniProt Gene Name

NME4

UniProt Synonym Gene Names

NM23D; NDK; NDP kinase, mitochondrial; NDPKD

UniProt Entry Name

NDKM_HUMAN

NCBI Protein Information

nucleoside diphosphate kinase, mitochondrial; NDK; NDPKD; NDP kinase D; NDP kinase, mitochondrial; nucleoside diphosphate kinase D; non-metastatic cells 4, protein expressed in

NCBI Summary for NME4

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]

UniProt Comments for NME4

NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.4.6; Kinase, nucleoside diphosphate; Nucleotide Metabolism - pyrimidine; Mitochondrial; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function: protein binding; metal ion binding; nucleoside diphosphate kinase activity; protein complex binding; ATP binding

Biological Process: regulation of apoptosis; GTP biosynthetic process; CTP biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; pyrimidine nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; UTP biosynthetic process; nucleoside triphosphate biosynthetic process; nucleoside metabolic process; nucleoside diphosphate phosphorylation; purine nucleotide metabolic process

Research Articles on NME4

1. Nm23-H4 acts as a lipid-dependent mitochondrial switch with dual function in phosphotransfer serving local GTP supply and cardiolipin transfer for apoptotic signaling and putative other functions

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NME4 antibody

Reference Product	PubMed Publications
AK1 antibody	>1 publications with NME4 and AK1

Pathways associated with anti-NME4 antibody

Products by Pathway	Pathway Diagram
Adenine Ribonucleotide Biosynthesis, IMP => ADP,ATP Pathway antibodies	Adenine Ribonucleotide Biosynthesis, IMP => ADP,ATP Pathway Diagram
Adenine Ribonucleotide Biosynthesis, IMP => ADP,ATP Pathway antibodies	Adenine Ribonucleotide Biosynthesis, IMP => ADP,ATP Pathway Diagram
Guanine Ribonucleotide Biosynthesis IMP => GDP,GTP Pathway antibodies	Guanine Ribonucleotide Biosynthesis IMP => GDP,GTP Pathway Diagram
Guanine Ribonucleotide Biosynthesis IMP => GDP,GTP Pathway antibodies	Guanine Ribonucleotide Biosynthesis IMP => GDP,GTP Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Nucleotides Pathway antibodies	Metabolism Of Nucleotides Pathway Diagram
Purine Metabolism Pathway antibodies	Purine Metabolism Pathway Diagram
Purine Metabolism Pathway antibodies	Purine Metabolism Pathway Diagram
Pyrimidine Metabolism Pathway antibodies	Pyrimidine Metabolism Pathway Diagram
Pyrimidine Metabolism Pathway antibodies	Pyrimidine Metabolism Pathway Diagram

Diseases associated with anti-NME4 antibody

Disease Name	Pubmed Publications
Lung Diseases Antibodies	>1 publications with NME4 and Lung Diseases
Nervous System Diseases Antibodies	>1 publications with NME4 and Nervous System Diseases
Neoplasm Metastasis Antibodies	>1 publications with NME4 and Neoplasm Metastasis
Cardiomyopathies Antibodies	>1 publications with NME4 and Cardiomyopathies
Cardiovascular Diseases Antibodies	>1 publications with NME4 and Cardiovascular Diseases
Breast Neoplasms Antibodies	>1 publications with NME4 and Breast Neoplasms
Anemia Antibodies	>1 publications with NME4 and Anemia
Inflammation Antibodies	>1 publications with NME4 and Inflammation
Kidney Diseases Antibodies	>1 publications with NME4 and Kidney Diseases

Organs/Tissues associated with anti-NME4 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>3 publications with NME4 and Liver
Stomach Antibodies	>3 publications with NME4 and Stomach
Kidney Antibodies	>2 publications with NME4 and Kidney
Blood Antibodies	>2 publications with NME4 and Blood
Muscle Antibodies	>2 publications with NME4 and Muscle
Lymph Node Antibodies	>2 publications with NME4 and Lymph Node
Heart Antibodies	>2 publications with NME4 and Heart
Ovary Antibodies	>1 publications with NME4 and Ovary
Intestine Antibodies	>1 publications with NME4 and Intestine
Embryonic Tissue Antibodies	>1 publications with NME4 and Embryonic Tissue