Mouse Anti-NMNAT2 Monoclonal Antibody – Cat# MBS6207624

NMNAT2 Antibody – Mouse Monoclonal

Name: NMNAT2 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6207624
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6207624

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus,… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NMNAT2, Monoclonal Antibody

Full Product Name

NMNAT2 (Nicotinamide Nucleotide adenylyltransferase 2, C1orf15, KIAA0479, MGC2756, PNAT-2, PNAT2) (MaxLight 490)

Product Gene Name

anti-NMNAT2 antibody

Product Synonym Names

Nicotinamide Nucleotide adenylyltransferase 2; C1orf15; KIAA0479; MGC2756; PNAT-2; PNAT2

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

4000000

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes NMNAT2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

36.6 kDa (327aa)

OMIM

608701

3D Structure

ModBase 3D Structure for Q9BZQ4

Immunogen

NMNAT2 (NP_055854, 208aa-307aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG

Conjugate

MaxLight490

Product Categories/Family for anti-NMNAT2 antibody

Antibodies; Enzymes; Transferase

Applications Tested/Suitable for anti-NMNAT2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-NMNAT2 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-NMNAT2 antibody

1. Nmnat2 delays axon degeneration in superior cervical ganglia dependent on its NAD synthesis activity. Yan T, Feng Y, Zheng J, Ge X, Zhang Y, Wu D, Zhao J, Zhai Q.Neurochem Int. 2009 Sep 22.

Other Notes

Small volumes of anti-NMNAT2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NMNAT2 purchase

MBS6207624 is an antibody targeting NMNAT2. Also known as NMNAT2 (Nicotinamide Nucleotide adenylyltransferase 2, C1orf15, KIAA0479, MGC2756, PNAT-2, PNAT2) (MaxLight 490). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NMNAT2. It may not necessarily be applicable to this product.

NCBI GI #

24307989

NCBI GeneID

23057

NCBI Accession #

NP_055854

UniProt Primary Accession #

Q9BZQ4

UniProt Secondary Accession #

O75067; Q5T1Q3; Q8WU99; Q96QW1

UniProt Related Accession #

Q9BZQ4

GenBank Nucleotide #

NM_015039.3

NCBI Official Full Name

nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 isoform 1

NCBI Official Synonym Full Names

nicotinamide nucleotide adenylyltransferase 2

NCBI Official Symbol

NMNAT2

NCBI Official Synonym Symbols

PNAT2; C1orf15

UniProt Protein Name

Nicotinamide mononucleotide adenylyltransferase 2

UniProt Synonym Protein Names

Nicotinate-nucleotide adenylyltransferase 2 (EC:2.7.7.18); NaMN adenylyltransferase 2

UniProt Gene Name

NMNAT2

UniProt Synonym Gene Names

C1orf15; KIAA0479; NMN adenylyltransferase 2; NaMN adenylyltransferase 2

UniProt Entry Name

NMNA2_HUMAN

NCBI Protein Information

nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2

UniProt Comments for NMNAT2

NMNAT2: Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate but with a lower efficiency. Cannot use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity prefers NAD(+), NADH and NAAD as substrates and degrades nicotinic acid adenine dinucleotide phosphate (NHD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Belongs to the eukaryotic NMN adenylyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.18; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.7.7.1

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: Golgi membrane; Golgi apparatus; late endosome; synapse; trans-Golgi network

Molecular Function: nicotinamide-nucleotide adenylyltransferase activity; nicotinate-nucleotide adenylyltransferase activity; ATP binding

Biological Process: NAD biosynthetic process; vitamin metabolic process; NAD metabolic process; water-soluble vitamin metabolic process

Research Articles on NMNAT2

1. Data indicate a chaperone function of nicotinamide mononucleotide adenylyl transferase 2 (NMNAT2), independent from its enzymatic activity, and NMNAT2 complexes with heat shock protein 90 (HSP90) to refold aggregated protein substrates.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-NMNAT2 antibody

Products by Pathway	Pathway Diagram
Metabolic Pathways antibodies	Metabolic Pathways Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Vitamins And Cofactors Pathway antibodies	Metabolism Of Vitamins And Cofactors Pathway Diagram
Metabolism Of Water-soluble Vitamins And Cofactors Pathway antibodies	Metabolism Of Water-soluble Vitamins And Cofactors Pathway Diagram
NAD+ Metabolism Pathway antibodies	NAD+ Metabolism Pathway Diagram
Nicotinate And Nicotinamide Metabolism Pathway antibodies	Nicotinate And Nicotinamide Metabolism Pathway Diagram
Nicotinate And Nicotinamide Metabolism Pathway antibodies	Nicotinate And Nicotinamide Metabolism Pathway Diagram
Nicotinate Metabolism Pathway antibodies	Nicotinate Metabolism Pathway Diagram

Diseases associated with anti-NMNAT2 antibody

Disease Name	Pubmed Publications
Nervous System Diseases Antibodies	>2 publications with NMNAT2 and Nervous System Diseases
Disease Models, Animal Antibodies	>2 publications with NMNAT2 and Disease Models, Animal
Hypertrophy Antibodies	>1 publications with NMNAT2 and Hypertrophy
Cardiovascular Diseases Antibodies	>1 publications with NMNAT2 and Cardiovascular Diseases
Lung Neoplasms Antibodies	>1 publications with NMNAT2 and Lung Neoplasms

Organs/Tissues associated with anti-NMNAT2 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>8 publications with NMNAT2 and Brain
Embryonic Tissue Antibodies	>4 publications with NMNAT2 and Embryonic Tissue
Muscle Antibodies	>3 publications with NMNAT2 and Muscle
Eye Antibodies	>1 publications with NMNAT2 and Eye
Blood Antibodies	>1 publications with NMNAT2 and Blood
Heart Antibodies	>1 publications with NMNAT2 and Heart
Lung Antibodies	>1 publications with NMNAT2 and Lung