Mouse Anti-CEBPG Monoclonal Antibody – Cat# MBS6210750

CEBPG Antibody – Mouse Monoclonal

Name: CEBPG Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6210750
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6210750

Transcription factor that binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit them to unusual DNA sites. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CEBPG, Monoclonal Antibody

Full Product Name

CEBPG (CCAAT/Enhancer-binding Protein gamma, C/EBP gamma) (MaxLight 550)

Product Gene Name

anti-CEBPG antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

3A3-1A6

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CEBPG.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Full length recombinant corresponding to aa1-150 from human CEBPG (AAH13128) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Conjugate

MaxLight550

Product Categories/Family for anti-CEBPG antibody

Antibodies; DNA Repair/Damage

Applications Tested/Suitable for anti-CEBPG antibody

FLISA, Western Blot (WB)

Application Notes for anti-CEBPG antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-CEBPG antibody

1. CEBPG regulates ERCC5/XPG expression in human bronchial epithelial cells and this regulation is modified by E2F1/YY1 interactions. Crawford EL, Blomquist T, Mullins DN, Yoon Y, Hernandez DR, Al-Bagdhadi M, Ruiz J, Hammersley J, Willey JC.Carcinogenesis. 2007 Dec;28(12):2552-9. Epub 2007 Sep 24.

Other Notes

Small volumes of anti-CEBPG antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CEBPG purchase

MBS6210750 is an antibody targeting CEBPG. Also known as CEBPG (CCAAT/Enhancer-binding Protein gamma, C/EBP gamma) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CEBPG. It may not necessarily be applicable to this product.

NCBI GI #

15341888

NCBI GeneID

1054

NCBI Accession #

BC013128

NCBI Related Accession #

AAH13128

UniProt Related Accession #

P53567

NCBI Official Full Name

Homo sapiens CCAAT/enhancer binding protein (C/EBP), gamma, mRNA

NCBI Official Synonym Full Names

CCAAT enhancer binding protein gamma

NCBI Official Symbol

CEBPG

NCBI Official Synonym Symbols

GPE1BP; IG/EBP-1

Protein Family

CCAAT/enhancer-binding protein

NCBI Protein Information

CCAAT/enhancer-binding protein gamma

NCBI Summary for CEBPG

The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2011]

Research Articles on CEBPG

1. The study aimed to identify a small set of genetic signatures that may reliably predict the individuals with a high genetic propensity to heroin addiction. A set of 4 genes (JUN, CEBPB, PRKCB, ENO2, or CEBPG) could predict the diagnosis of heroin addiction with the accuracy rate around 85% in our dataset.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.