Mouse Anti-COG2 Monoclonal Antibody – Cat# MBS6210887

COG2 Antibody – Mouse Monoclonal

Name: COG2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6210887
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6210887

MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

COG2, Monoclonal Antibody

Full Product Name

COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 550)

Product Gene Name

anti-COG2 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

4C8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human COG2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

83kDa

OMIM

606974

3D Structure

ModBase 3D Structure for Q14746

Immunogen

Partial recombinant corresponding to aa639-739 from COG2 (NP_031383) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP*

Conjugate

MaxLight550

Product Categories/Family for anti-COG2 antibody

Antibodies; Golgi Proteins

Applications Tested/Suitable for anti-COG2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-COG2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-COG2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for COG2 purchase

MBS6210887 is an antibody targeting COG2. Also known as COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for COG2. It may not necessarily be applicable to this product.

NCBI GI #

6678676

NCBI GeneID

22796

NCBI Accession #

NP_031383

UniProt Primary Accession #

Q14746

UniProt Related Accession #

Q14746

GenBank Nucleotide #

NM_007357

NCBI Official Full Name

conserved oligomeric Golgi complex subunit 2 isoform 1

NCBI Official Synonym Full Names

component of oligomeric golgi complex 2

NCBI Official Symbol

COG2

NCBI Official Synonym Symbols

LDLC; CDG2Q

UniProt Protein Name

Conserved oligomeric Golgi complex subunit 2

UniProt Synonym Protein Names

Component of oligomeric Golgi complex 2; Low density lipoprotein receptor defect C-complementing protein

Protein Family

Conserved oligomeric Golgi complex

UniProt Gene Name

COG2

UniProt Synonym Gene Names

LDLC; COG complex subunit 2

UniProt Entry Name

COG2_HUMAN

NCBI Protein Information

conserved oligomeric Golgi complex subunit 2

NCBI Summary for COG2

This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]

UniProt Comments for COG2

COG2: Required for normal Golgi morphology and function. Belongs to the COG2 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q42.2

Cellular Component: Golgi membrane; Golgi stack; Golgi transport complex; cytosol

Molecular Function: protein binding; protein complex binding; protein transporter activity

Biological Process: intracellular protein transport; intra-Golgi vesicle-mediated transport; oligosaccharide biosynthetic process; protein amino acid glycosylation; Golgi organization and biogenesis

Research Articles on COG2

1. Our data strongly suggest that these compound heterozygous mutations in COG2 are causative of CDG.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.