Mouse Anti-HMG2L1 Monoclonal Antibody – Cat# MBS6211908

HMG2L1 Antibody – Mouse Monoclonal

Name: HMG2L1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6211908
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6211908

MBS6211908 is an antibody targeting HMG2L1. Also known as HMG2L1 (HMG Domain-containing Protein 4, HMG Box-containing Protein 4, High Mobility Group Protein 2-like 1, Protein HMGBCG, HMGXB4, HMGBCG) (MaxLight 550). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HMG2L1, Monoclonal Antibody

Full Product Name

HMG2L1 (HMG Domain-containing Protein 4, HMG Box-containing Protein 4, High Mobility Group Protein 2-like 1, Protein HMGBCG, HMGXB4, HMGBCG) (MaxLight 550)

Product Gene Name

anti-HMG2L1 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

3C12

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human HMG2L1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

604702

3D Structure

ModBase 3D Structure for Q9UGU5

Immunogen

Partial recombinant corresponding to aa1-74 from HMG2L1 (NP_001003681) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK

Conjugate

MaxLight550

Product Categories/Family for anti-HMG2L1 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-HMG2L1 antibody

FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)

Application Notes for anti-HMG2L1 antibody

IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HMG2L1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HMG2L1. It may not necessarily be applicable to this product.

NCBI GI #

1519243087

NCBI GeneID

10042

NCBI Accession #

NM_001003681.3

UniProt Primary Accession #

Q9UGU5

UniProt Related Accession #

Q9UGU5

GenBank Nucleotide #

NM_001003681

NCBI Official Full Name

Homo sapiens HMG-box containing 4 (HMGXB4), transcript variant 1, mRNA

NCBI Official Synonym Full Names

HMG-box containing 4

NCBI Official Symbol

HMGXB4

NCBI Official Synonym Symbols

HMG2L1; HMGBCG; THC211630

UniProt Protein Name

HMG domain-containing protein 4

UniProt Synonym Protein Names

HMG box-containing protein 4; High mobility group protein 2-like 1; Protein HMGBCG

UniProt Gene Name

HMGXB4

UniProt Synonym Gene Names

HMG2L1; HMGBCG

UniProt Entry Name

HMGX4_HUMAN

NCBI Protein Information

HMG domain-containing protein 4

NCBI Summary for HMG2L1

High mobility group (HMG) proteins are nonhistone chromosomal proteins. See HMG2 (MIM 163906) for additional information on HMG proteins.[supplied by OMIM, Nov 2010]

UniProt Comments for HMG2L1

HMG2L1: Negatively regulates Wnt/beta-catenin signaling during development.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 22q13.1

Molecular Function: DNA binding; chromatin binding

Biological Process: chromatin remodeling; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; endosome to lysosome transport

Research Articles on HMG2L1

1. These results highlight a previously un-reported role of HMGXB4 in the hematopoietic system and transcriptional imbalances of HMGXB4 could contribute to the aberrant expansion of the megakaryocytic lineage in primary myelofibrosis patients

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.