Mouse Anti-HSD3B2 Monoclonal Antibody – Cat# MBS6211971

HSD3B2 Antibody – Mouse Monoclonal

Name: HSD3B2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6211971
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6211971

The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HSD3B2, Monoclonal Antibody

Full Product Name

HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta(5)-steroid Dehydrogenase, 3-beta-hydroxy-5-ene Ste

Product Gene Name

anti-HSD3B2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1E8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human HSD3B2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

42,052 Da

OMIM

201810

3D Structure

ModBase 3D Structure for P26439

Immunogen

Partial recombinant corresponding to aa33-122 from human HSD3B2 (NP_000189.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT

Conjugate

MaxLight550

Product Categories/Family for anti-HSD3B2 antibody

Antibodies; Enzymes; Dehydrogenase

Applications Tested/Suitable for anti-HSD3B2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-HSD3B2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HSD3B2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HSD3B2 purchase

MBS6211971 is an antibody targeting HSD3B2. Also known as HSD3B2 (HSDB3B, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 2, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type II, 3-beta-HSD Adrenal and Gonadal Type, 3-beta-hydroxy-Delta(5)-steroid Dehydrogenase, 3-beta-hydroxy-5-ene Ste. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HSD3B2. It may not necessarily be applicable to this product.

NCBI GI #

4504509

NCBI GeneID

3284

NCBI Accession #

NP_000189.1

UniProt Primary Accession #

P26439

UniProt Secondary Accession #

Q16010; Q53GD4; Q6AI10; Q6LDB9; Q99890; Q9UD08; A2RRA5

UniProt Related Accession #

P26439

GenBank Nucleotide #

NM_000198

NCBI Official Full Name

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2

NCBI Official Synonym Full Names

hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2

NCBI Official Symbol

HSD3B2

NCBI Official Synonym Symbols

HSDB; HSD3B; SDR11E2

UniProt Protein Name

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2

UniProt Synonym Protein Names

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II; 3-beta-HSD adrenal and gonadal typeIncluding the following 2 domains:3-beta-hydroxy-Delta(5)-steroid dehydrogenase (EC:1.1.1.145)Alternative name(s):3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase

Protein Family

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase

UniProt Gene Name

HSD3B2

UniProt Synonym Gene Names

HSDB3B; 3-beta-HSD II

UniProt Entry Name

3BHS2_HUMAN

NCBI Protein Information

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3-beta-HSD II; 3 beta-HSD type II; progesterone reductase; delta 5-delta 4-isomerase type II; 3-beta-HSD adrenal and gonadal type; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydr

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-HSD3B2 antibody

Products by Pathway	Pathway Diagram
Androgen Biosynthesis Pathway antibodies	Androgen Biosynthesis Pathway Diagram
C19/C18-Steroid Hormone Biosynthesis, Pregnenolone => Androstenedione => Estrone Pathway antibodies	C19/C18-Steroid Hormone Biosynthesis, Pregnenolone => Androstenedione => Estrone Pathway Diagram
C19/C18-Steroid Hormone Biosynthesis, Pregnenolone => Androstenedione => Estrone Pathway antibodies	C19/C18-Steroid Hormone Biosynthesis, Pregnenolone => Androstenedione => Estrone Pathway Diagram
Glucocorticoid & Mineralcorticoid Metabolism Pathway antibodies	Glucocorticoid & Mineralcorticoid Metabolism Pathway Diagram
Glucocorticoid Biosynthesis Pathway antibodies	Glucocorticoid Biosynthesis Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Lipids And Lipoproteins Pathway antibodies	Metabolism Of Lipids And Lipoproteins Pathway Diagram
Metabolism Of Steroid Hormones And Vitamins A And D Pathway antibodies	Metabolism Of Steroid Hormones And Vitamins A And D Pathway Diagram
Mineralocorticoid Biosynthesis Pathway antibodies	Mineralocorticoid Biosynthesis Pathway Diagram
Steroid Biosynthesis Pathway antibodies	Steroid Biosynthesis Pathway Diagram

Diseases associated with anti-HSD3B2 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>30 publications with HSD3B2 and Neoplasms
Hyperplasia Antibodies	>23 publications with HSD3B2 and Hyperplasia
Adrenal Hyperplasia, Congenital Antibodies	>22 publications with HSD3B2 and Adrenal Hyperplasia, Congenital
Prostatic Neoplasms Antibodies	>13 publications with HSD3B2 and Prostatic Neoplasms
Mental Disorders Antibodies	>6 publications with HSD3B2 and Mental Disorders
Necrosis Antibodies	>4 publications with HSD3B2 and Necrosis
Hypertension Antibodies	>4 publications with HSD3B2 and Hypertension
Polycystic Ovary Syndrome Antibodies	>4 publications with HSD3B2 and Polycystic Ovary Syndrome
Insulin Resistance Antibodies	>3 publications with HSD3B2 and Insulin Resistance
Hypospadias Antibodies	>3 publications with HSD3B2 and Hypospadias

Organs/Tissues associated with anti-HSD3B2 antibody

Organ/Tissue Name	Pubmed Publications
Adrenal Gland Antibodies	>37 publications with HSD3B2 and Adrenal Gland
Ovary Antibodies	>24 publications with HSD3B2 and Ovary
Placenta Antibodies	>9 publications with HSD3B2 and Placenta
Brain Antibodies	>4 publications with HSD3B2 and Brain
Thymus Antibodies	>1 publications with HSD3B2 and Thymus