Mouse Anti-LAMA5 Monoclonal Antibody – Cat# MBS6212268

LAMA5 Antibody – Mouse Monoclonal

Name: LAMA5 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6212268
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6212268

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LAMA5, Monoclonal Antibody

Full Product Name

LAMA5 (Laminin Subunit alpha-5, Laminin-10 Subunit alpha, Laminin-11 Subunit alpha, Laminin-15 Subunit alpha, KIAA0533, KIAA1907) (MaxLight 550)

Product Gene Name

anti-LAMA5 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2F7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human LAMA5.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa1-100 from human LAMA5 (AAH03355.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP

Conjugate

MaxLight550

Product Categories/Family for anti-LAMA5 antibody

Antibodies; Lamin; Laminin

Applications Tested/Suitable for anti-LAMA5 antibody

FLISA, Western Blot (WB)

Application Notes for anti-LAMA5 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-LAMA5 antibody

1. Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion. Little GH, Noushmehr H, Baniwal SK, Berman BP, Coetzee GA, Frenkel B.Nucleic Acids Res. 2011 Dec 19. 2. Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors. Oikawa Y, Hansson J, Sasaki T, Rousselle P, Domogatskaya A, Rodin S, Tryggvason K, Patarroyo M.Exp Cell Res. 2010 Dec 31. 3. Proteomics Analysis of Nasopharyngeal Carcinoma Cell Secretome Using a Hollow Fiber Culture System and Mass Spectrometry. Wu HY, Chang YH, Chang YC, Liao PC.J Proteome Res. 2009 Jan;8(1):380-9. 4. Proteomic analysis of platelet a-granules using mass spectrometry. Maynard DM, Heijnen HF, Horne MK, White JG, Gahl WA.J Thromb Haemost. 2007 Sep;5(9):1945-55.

Other Notes

Small volumes of anti-LAMA5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LAMA5 purchase

MBS6212268 is an antibody targeting LAMA5. Also known as LAMA5 (Laminin Subunit alpha-5, Laminin-10 Subunit alpha, Laminin-11 Subunit alpha, Laminin-15 Subunit alpha, KIAA0533, KIAA1907) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LAMA5. It may not necessarily be applicable to this product.

NCBI GI #

13097167

NCBI GeneID

3911

NCBI Accession #

BC003355

NCBI Related Accession #

AAH03355.1

UniProt Related Accession #

O15230

NCBI Official Full Name

Homo sapiens laminin, alpha 5, mRNA

NCBI Official Synonym Full Names

laminin subunit alpha 5

NCBI Official Symbol

LAMA5

Protein Family

Laminin

NCBI Protein Information

laminin subunit alpha-5

NCBI Summary for LAMA5

This gene encodes one of the vertebrate laminin alpha chains. Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. The protein encoded by this gene is the alpha-5 subunit of of laminin-10 (laminin-511), laminin-11 (laminin-521) and laminin-15 (laminin-523). [provided by RefSeq, Jun 2013]

Research Articles on LAMA5

1. Dominant mutation in the LAMA5 gene is associated with vitreous detachment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.