Mouse Anti-LATS1 Monoclonal Antibody – Cat# MBS6212282

LATS1 Antibody – Mouse Monoclonal

Name: LATS1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6212282
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6212282

The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

LATS1, Monoclonal Antibody

Full Product Name

LATS1 (WARTS, Serine/Threonine-protein Kinase LATS1, Large Tumor Suppressor Homolog 1, WARTS Protein Kinase) (MaxLight 550)

Product Gene Name

anti-LATS1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3A7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human LATS1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

AF104413 mRNA

3D Structure

ModBase 3D Structure for O95835

Immunogen

Partial recombinant corresponding to aa521-620 from LATS1 (NP_004681) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN

Conjugate

MaxLight550

Product Categories/Family for anti-LATS1 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-LATS1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-LATS1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-LATS1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for LATS1 purchase

MBS6212282 is an antibody targeting LATS1. Also known as LATS1 (WARTS, Serine/Threonine-protein Kinase LATS1, Large Tumor Suppressor Homolog 1, WARTS Protein Kinase) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for LATS1. It may not necessarily be applicable to this product.

NCBI GI #

1519246067

NCBI GeneID

9113

NCBI Accession #

NM_004690.4

UniProt Primary Accession #

O95835

UniProt Related Accession #

O95835

GenBank Nucleotide #

NM_004690

NCBI Official Full Name

Homo sapiens large tumor suppressor kinase 1 (LATS1), transcript variant 1, mRNA

NCBI Official Synonym Full Names

large tumor suppressor kinase 1

NCBI Official Symbol

LATS1

NCBI Official Synonym Symbols

wts; WARTS

UniProt Protein Name

Serine/threonine-protein kinase LATS1

UniProt Synonym Protein Names

Large tumor suppressor homolog 1; WARTS protein kinase; h-warts

Protein Family

Serine/threonine-protein kinase

UniProt Gene Name

LATS1

UniProt Synonym Gene Names

h-warts

NCBI Protein Information

serine/threonine-protein kinase LATS1

UniProt Comments for LATS1

LATS1: an AGC kinase of the NDR family of kinases. Localized to the mitotic apparatus and specifically phosphorylated during mitosis. A likely tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDC2 kinase activity, causing G2 arrest. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. Complexes with CDC2 in early mitosis. LATS1-associated CDC2 has no mitotic cyclin partner and no apparent kinase activity. Binds phosphorylated zyxin, locating this protein to the mitotic spindle and suggesting a role for actin regulatory proteins during mitosis. Binds to and colocalizes with LIMK1 at the actomyosin contractile ring during cytokinesis. Knockout mice are susceptible to soft-tissue sarcomas and sensitive to chemical carcinogenesis. Human soft tissue sarcomas have downregulated, mutated, and/or hypermethylated LATS1. Transgenic expression blocks anchorage independent growth in culture and tumor growth in xenografts. Two alternatively spliced isoforms of the human proteinhave been described.

Protein type: AGC group; EC 2.7.11.1; Kinase, protein; NDR family; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Tumor suppressor

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: cytosol; spindle pole

Molecular Function: ATP binding; estrogen receptor binding; magnesium ion binding; protein binding; protein kinase binding; protein serine/threonine kinase activity

Biological Process: cytoplasmic sequestering of protein; G1/S transition of mitotic cell cycle; G2/M transition of mitotic cell cycle; hormone-mediated signaling; negative regulation of cyclin-dependent protein kinase activity; positive regulation of apoptosis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation; regulation of actin filament polymerization; regulation of estrogen receptor signaling pathway; regulation of organ growth; regulation of protein complex assembly; sister chromatid segregation

Research Articles on LATS1

1. Study reports a kinase activity-independent role of LATS1, but not LATS2, in regulating therapy-induced autophagy in hepatocellular carcinoma (HCC) cells. The results indicate that this scaffolding function of LATS1 plays a critical role in the regulation of autophagy and in therapy response of HCC cells and potentially other cancer type cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.