• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PIGH Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6213157

This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PIGH, Monoclonal Antibody
Full Product Name
PIGH (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit H, Phosphatidylinositol-glycan Biosynthesis Class H Protein) (MaxLight 550)
Product Gene Name
anti-PIGH antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PIGH.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
600154
3D Structure
ModBase 3D Structure for Q14442
Immunogen
Partial recombinant corresponding to aa89-189 from human PIGH (NP_004560) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP
Conjugate
MaxLight550

Product Categories/Family for anti-PIGH antibody

Antibodies; Enzymes; Phospholipase
Applications Tested/Suitable for anti-PIGH antibody
FLISA, Western Blot (WB)
Application Notes for anti-PIGH antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PIGH antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PIGH purchase

MBS6213157 is an antibody targeting PIGH. Also known as PIGH (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit H, Phosphatidylinositol-glycan Biosynthesis Class H Protein) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PIGH. It may not necessarily be applicable to this product.

NCBI GI #
4758920
NCBI GeneID
5283
NCBI Accession #
NP_004560
UniProt Primary Accession #
Q14442
UniProt Related Accession #
Q14442
GenBank Nucleotide #
NM_004569
NCBI Official Full Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit H isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class H
NCBI Official Symbol
PIGH
NCBI Official Synonym Symbols
GPI-H
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
UniProt Synonym Protein Names
Phosphatidylinositol-glycan biosynthesis class H protein
Protein Family
4-hydroxy-2,2'-bipyrrole-5-methanol synthase
UniProt Gene Name
PIGH
UniProt Synonym Gene Names
PIG-H
UniProt Entry Name
PIGH_HUMAN
NCBI Protein Information
phosphatidylinositol N-acetylglucosaminyltransferase subunit H

UniProt Comments for PIGH

PIGH: Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Belongs to the PIGH family.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; EC 2.4.1.198; Endoplasmic reticulum; Transferase

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: endoplasmic reticulum membrane; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex; endoplasmic reticulum

Molecular Function: phosphatidylinositol N-acetylglucosaminyltransferase activity; catalytic activity

Biological Process: cellular protein metabolic process; preassembly of GPI anchor in ER membrane; GPI anchor biosynthetic process; protein modification process; C-terminal protein lipidation; post-translational protein modification
Show more

Research Articles on PIGH

1. The GPI-anchor negative phenotype results from loss of mRNA expression of the PIGH gene, which is involved in the first step of GPI-anchor synthesis. Loss of PIGH mRNA expression within these B-ALL cells follows epigenetic silencing rather than gene mutation or deletion.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PIGH antibody

 Reference Product  PubMed Publications
 PIGA antibody  >4 publications with PIGH and PIGA

Pathways associated with anti-PIGH antibody

 Products by Pathway  Pathway Diagram
 Glycosylphosphatidylinositol(GPI)-anchor Biosynthesis Pathway antibodies  Glycosylphosphatidylinositol(GPI)-anchor Biosynthesis Pathway Diagram
 Glycosylphosphatidylinositol(GPI)-anchor Biosynthesis Pathway antibodies  Glycosylphosphatidylinositol(GPI)-anchor Biosynthesis Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Post-translational Modification: Synthesis Of GPI-anchored Proteins Pathway antibodies  Post-translational Modification: Synthesis Of GPI-anchored Proteins Pathway Diagram
 Post-translational Protein Modification Pathway antibodies  Post-translational Protein Modification Pathway Diagram
 Synthesis Of Glycosylphosphatidylinositol (GPI) Pathway antibodies  Synthesis Of Glycosylphosphatidylinositol (GPI) Pathway Diagram

Diseases associated with anti-PIGH antibody

 Disease Name  Pubmed Publications
 Anemia Antibodies  >2 publications with PIGH and Anemia
 Carcinoma Antibodies  >1 publications with PIGH and Carcinoma
 Neoplasms Antibodies  >1 publications with PIGH and Neoplasms
 Inflammation Antibodies  >1 publications with PIGH and Inflammation
 Hyperplasia Antibodies  >1 publications with PIGH and Hyperplasia

Organs/Tissues associated with anti-PIGH antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >1 publications with PIGH and Blood
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000