Mouse Anti-TRIM23 Monoclonal Antibody – Cat# MBS6214528

TRIM23 Antibody – Mouse Monoclonal

Name: TRIM23 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6214528
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6214528

Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection.… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TRIM23, Monoclonal Antibody

Full Product Name

TRIM23 (E3 Ubiquitin-protein Ligase TRIM23, ADP-ribosylation Factor Domain-containing Protein 1, GTP-binding Protein ARD-1, RING Finger Protein 46, Tripartite Motif-containing Protein 23, ARD1, ARFD1, RNF46) (MaxLight 550)

Product Gene Name

anti-TRIM23 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

2H4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TRIM23.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

61,068 Da

Immunogen

Partial recombinant corresponding to aa1-110 from human TRIM23 (AAH22510) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQY

Conjugate

MaxLight550

Product Categories/Family for anti-TRIM23 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-TRIM23 antibody

FLISA, Western Blot (WB)

Application Notes for anti-TRIM23 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-TRIM23 antibody

1. Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense. Arimoto K, Funami K, Saeki Y, Tanaka K, Okawa K, Takeuchi O, Akira S, Murakami Y, Shimotohno K.Proc Natl Acad Sci U S A. 2010 Sep 7;107(36):15856-61. Epub 2010 Aug 19.

Other Notes

Small volumes of anti-TRIM23 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TRIM23 purchase

MBS6214528 is an antibody targeting TRIM23. Also known as TRIM23 (E3 Ubiquitin-protein Ligase TRIM23, ADP-ribosylation Factor Domain-containing Protein 1, GTP-binding Protein ARD-1, RING Finger Protein 46, Tripartite Motif-containing Protein 23, ARD1, ARFD1, RNF46) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TRIM23. It may not necessarily be applicable to this product.

NCBI GI #

18490295

NCBI GeneID

373

NCBI Accession #

BC022510

NCBI Related Accession #

AAH22510

UniProt Secondary Accession #

Q9BZY4; Q9BZY5

UniProt Related Accession #

P36406

NCBI Official Full Name

Homo sapiens tripartite motif-containing 23, mRNA

NCBI Official Synonym Full Names

tripartite motif containing 23

NCBI Official Symbol

TRIM23

NCBI Official Synonym Symbols

ARD1; ARFD1; RNF46

Protein Family

E3 ubiquitin-protein ligase

NCBI Protein Information

E3 ubiquitin-protein ligase TRIM23

NCBI Summary for TRIM23

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. [provided by RefSeq, Jul 2008]

Research Articles on TRIM23

1. TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPARgamma2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-TRIM23 antibody

Disease Name	Pubmed Publications
Kidney Diseases Antibodies	>1 publications with TRIM23 and Kidney Diseases
Carcinoma Antibodies	>1 publications with TRIM23 and Carcinoma
Necrosis Antibodies	>1 publications with TRIM23 and Necrosis
Neoplasms Antibodies	>1 publications with TRIM23 and Neoplasms

Organs/Tissues associated with anti-TRIM23 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>3 publications with TRIM23 and Blood
Liver Antibodies	>3 publications with TRIM23 and Liver
Muscle Antibodies	>1 publications with TRIM23 and Muscle
Brain Antibodies	>1 publications with TRIM23 and Brain