Mouse Anti-VASH1 Monoclonal Antibody – Cat# MBS6214731

Vasohibin-1 (VASH1) Antibody – Mouse Monoclonal

Name: VASH1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6214731
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6214731

MBS6214731 is an antibody targeting VASH1. Also known as Vasohibin-1 (VASH1, VASH, KIAA1036) (MaxLight 550). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Vasohibin-1 (VASH1), Monoclonal Antibody

Full Product Name

Vasohibin-1 (VASH1, VASH, KIAA1036) (MaxLight 550)

Product Gene Name

anti-VASH1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4A3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human VASH1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

609011

3D Structure

ModBase 3D Structure for Q7L8A9

Immunogen

Partial recombinant corresponding to aa3-101 from VASH1 (NP_055724) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD*

Conjugate

MaxLight550

Product Categories/Family for anti-VASH1 antibody

Antibodies; Angiogenesis

Applications Tested/Suitable for anti-VASH1 antibody

FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)

Application Notes for anti-VASH1 antibody

IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-VASH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for VASH1. It may not necessarily be applicable to this product.

NCBI GI #

1519473554

NCBI GeneID

22846

NCBI Accession #

NM_014909.5

UniProt Primary Accession #

Q7L8A9

UniProt Related Accession #

Q7L8A9

GenBank Nucleotide #

NM_014909

NCBI Official Full Name

Homo sapiens vasohibin 1 (VASH1), mRNA

NCBI Official Synonym Full Names

vasohibin 1

NCBI Official Symbol

VASH1

NCBI Official Synonym Symbols

TTCP 1; KIAA1036

UniProt Protein Name

Vasohibin-1

Protein Family

Vasohibin

UniProt Gene Name

VASH1

UniProt Synonym Gene Names

KIAA1036; VASH

UniProt Entry Name

VASH1_HUMAN

NCBI Protein Information

tubulinyl-Tyr carboxypeptidase 1

UniProt Comments for VASH1

VASH1: Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage infiltration. Exhibits heparin-binding activity. Belongs to the vasohibin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: extracellular space; endoplasmic reticulum; apical part of cell; cytoplasm

Biological Process: negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; response to wounding; angiogenesis; negative regulation of blood vessel endothelial cell migration; cell cycle arrest

Research Articles on VASH1

1. This study examined the crystal structures of human vasohibin 1 and 2 in complex with small vasohibin-binding protein (SVBP) in the absence and presence of different inhibitors and a C-terminal alpha-tubulin peptide.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.