Mouse Anti-YAP1 Monoclonal Antibody – Cat# MBS6214802

YAP1 Antibody – Mouse Monoclonal

Name: YAP1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6214802
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6214802

MBS6214802 is an antibody targeting YAP1. Also known as YAP1 (65kD Yes-associated Protein, YAP65, Yorkie Homolog) (MaxLight 550). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

YAP1, Monoclonal Antibody

Full Product Name

YAP1 (65kD Yes-associated Protein, YAP65, Yorkie Homolog) (MaxLight 550)

Product Gene Name

anti-YAP1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2F12

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human YAP1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa53-161 from YAP1 (NP_006097) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR

Conjugate

MaxLight550

Product Categories/Family for anti-YAP1 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-YAP1 antibody

FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)

Application Notes for anti-YAP1 antibody

IF: 30ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-YAP1 antibody

1. Tead4 is constitutively nuclear, while nuclear vs. cytoplasmic Yap distribution is regulated in preimplantation mouse embryos. Hirate Y, Cockburn K, Rossant J, Sasaki H.Proc Natl Acad Sci U S A. 2012 Dec 11;109(50):E3389-90. doi: 10.1073/pnas.1211810109. Epub 2012 Nov 20. 2. YAP1 Recruits c-Abl to Protect Angiomotin-Like 1 from Nedd4-Mediated Degradation. Skouloudaki K, Walz G.PLoS One. 2012;7(4):e35735. Epub 2012 Apr 27. 3. Hippo pathway regulation by cell morphology and stress fibers. Wada K, Itoga K, Okano T, Yonemura S, Sasaki H.Development. 2011 Sep;138(18):3907-14. Epub 2011 Aug 10. 4. Inactivation of Merlin in malignant mesothelioma cells and the Hippo signaling cascade dysregulation. Sekido Y.Pathol Int. 2011 Jun;61(6):331-44. doi: 10.1111/j.1440-1827.2011.02666.x. Epub 2011 May 2. 5. Identification of miR-193b targets in breast cancer cells and systems biological analysis of their functional impact. Leivonen SK, Rokka A, Ostling P, Kohonen P, Corthals GL, Kallioniemi O, Perala M.Mol Cell Proteomics. 2011 Apr 21. 6. LATS2 Is a Tumor Suppressor Gene of Malignant Mesothelioma. Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, Akatsuka S, Horio Y, Hida T, Kondo Y, Toyokuni S, Osada H, Sekido Y.Cancer Res. 2011 Feb 1;71(3):873-83. Epub 2011 Jan 18. 7. JNK phosphorylates Yes-associated protein (YAP) to regulate apoptosis. V Tomlinson, K Gudmundsdottir, P Luong, K-Y Leung, A Knebel, S Basu.Cell Death and Disease (2010) 1, e29; doi:10.1038/cddis.2010.7 8. Merlin Is a Potent Inhibitor of Glioma Growth. Lau YK, Murray LB, Houshmandi SS, Xu Y, Gutmann DH, Yu Q.Cancer Res. 2008 Jul 15;68(14):5733-42.

Other Notes

Small volumes of anti-YAP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for YAP1. It may not necessarily be applicable to this product.

NCBI GI #

303523511

NCBI GeneID

10413

NCBI Accession #

NP_006097

UniProt Related Accession #

P46937

GenBank Nucleotide #

NM_006106

NCBI Official Full Name

transcriptional coactivator YAP1 isoform 2

NCBI Official Synonym Full Names

Yes1 associated transcriptional regulator

NCBI Official Symbol

YAP1

NCBI Official Synonym Symbols

YAP; YKI; COB1; YAP2; YAP65

Protein Family

AP-1-like transcription factor

NCBI Protein Information

transcriptional coactivator YAP1

NCBI Summary for YAP1

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]

Research Articles on YAP1

1. High YAP1 expression is associated with hepatic Fibrolamellar Carcinoma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-YAP1 antibody

Reference Product	PubMed Publications
LATS1 antibody	>53 publications with YAP1 and LATS1
LATS2 antibody	>27 publications with YAP1 and LATS2
TEAD1 antibody	>25 publications with YAP1 and TEAD1
TEAD4 antibody	>11 publications with YAP1 and TEAD4
AMOT antibody	>11 publications with YAP1 and AMOT
TEAD2 antibody	>8 publications with YAP1 and TEAD2
TEAD3 antibody	>3 publications with YAP1 and TEAD3
SMAD7 antibody	>1 publications with YAP1 and SMAD7
TP73 antibody	>1 publications with YAP1 and TP73

Pathways associated with anti-YAP1 antibody

Products by Pathway	Pathway Diagram
ErbB4 Signaling Events Pathway antibodies	ErbB4 Signaling Events Pathway Diagram
Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies	Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
Gene Expression Pathway antibodies	Gene Expression Pathway Diagram
Generic Transcription Pathway antibodies	Generic Transcription Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
Hippo Signaling Pathway antibodies	Hippo Signaling Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Lipids And Lipoproteins Pathway antibodies	Metabolism Of Lipids And Lipoproteins Pathway Diagram

Diseases associated with anti-YAP1 antibody

Disease Name	Pubmed Publications
Adenocarcinoma Antibodies	>63 publications with YAP1 and Adenocarcinoma
Cell Transformation, Neoplastic Antibodies	>42 publications with YAP1 and Cell Transformation, Neoplastic
Liver Neoplasms Antibodies	>40 publications with YAP1 and Liver Neoplasms
Liver Diseases Antibodies	>36 publications with YAP1 and Liver Diseases
Carcinoma, Hepatocellular Antibodies	>35 publications with YAP1 and Carcinoma, Hepatocellular
Breast Neoplasms Antibodies	>30 publications with YAP1 and Breast Neoplasms
Lung Neoplasms Antibodies	>27 publications with YAP1 and Lung Neoplasms
Nervous System Diseases Antibodies	>21 publications with YAP1 and Nervous System Diseases
Disease Models, Animal Antibodies	>18 publications with YAP1 and Disease Models, Animal
Neoplasms, Experimental Antibodies	>18 publications with YAP1 and Neoplasms, Experimental

Organs/Tissues associated with anti-YAP1 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>55 publications with YAP1 and Liver
Lung Antibodies	>38 publications with YAP1 and Lung
Muscle Antibodies	>32 publications with YAP1 and Muscle
Brain Antibodies	>27 publications with YAP1 and Brain
Kidney Antibodies	>18 publications with YAP1 and Kidney
Vascular Antibodies	>17 publications with YAP1 and Vascular
Connective Tissue Antibodies	>17 publications with YAP1 and Connective Tissue
Ovary Antibodies	>16 publications with YAP1 and Ovary
Skin Antibodies	>16 publications with YAP1 and Skin
Stomach Antibodies	>14 publications with YAP1 and Stomach