Mouse Anti-FKBP10 Monoclonal Antibody – Cat# MBS6216875

FKBP10 Antibody – Mouse Monoclonal

Name: FKBP10 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6216875
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6216875

MBS6216875 is an antibody targeting FKBP10. Also known as FKBP10 (FK506 Binding Protein 10, 65kD, FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65) (MaxLight 550). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant FKBP10. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

FKBP10, Monoclonal Antibody

Full Product Name

FKBP10 (FK506 Binding Protein 10, 65kD, FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65) (MaxLight 550)

Product Gene Name

anti-FKBP10 antibody

Product Synonym Names

FK506 Binding Protein 10; 65 kD; FKBP6; FKBP65; FLJ20683; FLJ22041; FLJ23833; hFKBP65

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2D4

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified

Specificity

Recognizes FKBP10.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

65kDa

OMIM

gene 610968

3D Structure

ModBase 3D Structure for Q96AY3

Immunogen

FKBP10 (NP_068758, 377aa-470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV

Conjugate

MaxLight550

Product Categories/Family for anti-FKBP10 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-FKBP10 antibody

Western Blot (WB)

Application Notes for anti-FKBP10 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-FKBP10 antibody

1. A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect. Venturi G, Monti E, Carbonare LD, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F.Bone. 2011 Oct 30.

Other Notes

Small volumes of anti-FKBP10 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for FKBP10. It may not necessarily be applicable to this product.

NCBI GI #

192448443

NCBI GeneID

60681

NCBI Accession #

NP_068758

UniProt Primary Accession #

Q96AY3

UniProt Related Accession #

Q96AY3

GenBank Nucleotide #

NM_021939

NCBI Official Full Name

peptidyl-prolyl cis-trans isomerase FKBP10

NCBI Official Synonym Full Names

FKBP prolyl isomerase 10

NCBI Official Symbol

FKBP10

NCBI Official Synonym Symbols

OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65

UniProt Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP10

UniProt Synonym Protein Names

65 kDa FK506-binding protein; 65 kDa FKBP; FKBP-65; FK506-binding protein 10; FKBP-10; Immunophilin FKBP65; Rotamase

Protein Family

Peptidyl-prolyl cis-trans isomerase

UniProt Gene Name

FKBP10

UniProt Synonym Gene Names

FKBP65; PSEC0056; PPIase FKBP10; 65 kDa FKBP; FKBP-65; FKBP-10

UniProt Entry Name

FKB10_HUMAN

NCBI Protein Information

peptidyl-prolyl cis-trans isomerase FKBP10

NCBI Summary for FKBP10

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.[provided by RefSeq, Nov 2009]

UniProt Comments for FKBP10

FKBP10: PPIases accelerate the folding of proteins during protein synthesis. Defects in FKBP10 are the cause of osteogenesis imperfecta type 6 (OI6). OI6 is a moderate to severe, autosomal recessive form of osteogenesis imperfecta characterized by increased serum alkaline phosphatase levels and bone histology exhibiting a fish scale-like lamellar pattern. Osteogenesis imperfecta defines a group of connective tissue disorders characterized by bone fragility and low bone mass.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; FK506 binding; calcium ion binding

Biological Process: protein peptidyl-prolyl isomerization

Disease: Osteogenesis Imperfecta, Type Xi; Bruck Syndrome 1

Research Articles on FKBP10

1. FKBP10 interacts with collagen VI and deficiency of FKBP10 reduces lung fibroblast migration by down-regulation of collage VI synthesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-FKBP10 antibody

Disease Name	Pubmed Publications
Muscular Diseases Antibodies	>4 publications with FKBP10 and Muscular Diseases
Neoplasms Antibodies	>2 publications with FKBP10 and Neoplasms
Adenocarcinoma Antibodies	>1 publications with FKBP10 and Adenocarcinoma
Craniofacial Abnormalities Antibodies	>1 publications with FKBP10 and Craniofacial Abnormalities
Neoplasm Metastasis Antibodies	>1 publications with FKBP10 and Neoplasm Metastasis
Weight Gain Antibodies	>1 publications with FKBP10 and Weight Gain
Mental Disorders Antibodies	>1 publications with FKBP10 and Mental Disorders
Gonadal Disorders Antibodies	>1 publications with FKBP10 and Gonadal Disorders
Fibrosis Antibodies	>1 publications with FKBP10 and Fibrosis
Lung Diseases Antibodies	>1 publications with FKBP10 and Lung Diseases

Organs/Tissues associated with anti-FKBP10 antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>13 publications with FKBP10 and Bone
Lung Antibodies	>5 publications with FKBP10 and Lung
Vascular Antibodies	>3 publications with FKBP10 and Vascular
Muscle Antibodies	>3 publications with FKBP10 and Muscle
Connective Tissue Antibodies	>2 publications with FKBP10 and Connective Tissue
Skin Antibodies	>2 publications with FKBP10 and Skin
Adrenal Gland Antibodies	>1 publications with FKBP10 and Adrenal Gland
Heart Antibodies	>1 publications with FKBP10 and Heart
Uterus Antibodies	>1 publications with FKBP10 and Uterus
Embryonic Tissue Antibodies	>1 publications with FKBP10 and Embryonic Tissue