• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DHRS2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6221817

DHRS2 displays NADPH-dependent dicarbonyl reductase activity in vitro with 3,4-Hexanedione, 2,3-Heptanedione and 1-Phenyl-1,2-propanedione as substrates. DHRS2 do not reductase activity is displayed in vitro with steroids, retinoids and sugars as substrates.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DHRS2, Monoclonal Antibody
Full Product Name
DHRS2 (Dehydrogenase/Reductase SDR Family Member 2, Dicarbonyl Reductase HEP27, Protein D) (MaxLight 650)
Product Gene Name
anti-DHRS2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DHRS2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
31,496 Da
3D Structure
ModBase 3D Structure for Q13268
Immunogen
Partial recombinant corresponding to aa229-300 from DHRS2 (NP_878912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA
Conjugate
MaxLight650

Product Categories/Family for anti-DHRS2 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-DHRS2 antibody
FLISA, Western Blot (WB)
Application Notes for anti-DHRS2 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DHRS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DHRS2 purchase

MBS6221817 is an antibody targeting DHRS2. Also known as DHRS2 (Dehydrogenase/Reductase SDR Family Member 2, Dicarbonyl Reductase HEP27, Protein D) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DHRS2. It may not necessarily be applicable to this product.

NCBI GI #
33667109
NCBI GeneID
10202
NCBI Accession #
NP_878912
UniProt Primary Accession #
Q13268
UniProt Secondary Accession #
Q53GS4; Q7Z789; Q9H2R2; D3DS54
UniProt Related Accession #
Q13268
GenBank Nucleotide #
NM_182908
NCBI Official Full Name
dehydrogenase/reductase SDR family member 2, mitochondrial isoform 1
NCBI Official Synonym Full Names
dehydrogenase/reductase (SDR family) member 2
NCBI Official Symbol
DHRS2
NCBI Official Synonym Symbols
HEP27; SDR25C1
UniProt Protein Name
Dehydrogenase/reductase SDR family member 2
UniProt Synonym Protein Names
Dicarbonyl reductase HEP27; Protein D
Protein Family
Dehydrogenase/reductase SDR family
UniProt Gene Name
DHRS2
UniProt Entry Name
DHRS2_HUMAN
NCBI Protein Information
dehydrogenase/reductase SDR family member 2, mitochondrial; dehydrogenase/reductase member 2; dicarbonyl reductase HEP27; protein D; short chain dehydrogenase/reductase family 25C, member 1; short-chain alcohol dehydrogenase family member

UniProt Comments for DHRS2

DHRS2: Displays NADPH-dependent dicarbonyl reductase activity in vitro with 3,4-Hexanedione, 2,3-Heptanedione and 1-Phenyl-1,2- propanedione as substrates. No reductase activity is displayed in vitro with steroids, retinoids and sugars as substrates. May inhibit cell replication. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.1.1.-; Oxidoreductase; EC 1.1.-.-

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm; nuclear envelope; nucleus

Molecular Function: carbonyl reductase (NADPH) activity

Biological Process: negative regulation of cell proliferation; response to toxin; C21-steroid hormone metabolic process; myeloid dendritic cell differentiation; negative regulation of apoptosis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-DHRS2 antibody

 Disease Name  Pubmed Publications
 Carcinoma, Hepatocellular Antibodies  >2 publications with DHRS2 and Carcinoma, Hepatocellular
 Breast Neoplasms Antibodies  >2 publications with DHRS2 and Breast Neoplasms
 Liver Neoplasms Antibodies  >1 publications with DHRS2 and Liver Neoplasms
 Cardiovascular Diseases Antibodies  >1 publications with DHRS2 and Cardiovascular Diseases
 Neoplasm Metastasis Antibodies  >1 publications with DHRS2 and Neoplasm Metastasis
 Liver Diseases Antibodies  >1 publications with DHRS2 and Liver Diseases
 Adenocarcinoma Antibodies  >1 publications with DHRS2 and Adenocarcinoma
 Fatty Liver Antibodies  >1 publications with DHRS2 and Fatty Liver
 Ovarian Neoplasms Antibodies  >1 publications with DHRS2 and Ovarian Neoplasms

Organs/Tissues associated with anti-DHRS2 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >3 publications with DHRS2 and Liver
 Blood Antibodies  >2 publications with DHRS2 and Blood
 Ovary Antibodies  >1 publications with DHRS2 and Ovary
 Lymph Antibodies  >1 publications with DHRS2 and Lymph
 Testis Antibodies  >1 publications with DHRS2 and Testis
 Embryonic Tissue Antibodies  >1 publications with DHRS2 and Embryonic Tissue
 Kidney Antibodies  >1 publications with DHRS2 and Kidney
 Placenta Antibodies  >1 publications with DHRS2 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000