Mouse Anti-GTF2A1 Monoclonal Antibody – Cat# MBS6222476

GTF2A1 Antibody – Mouse Monoclonal

Name: GTF2A1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6222476
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6222476

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

GTF2A1, Monoclonal Antibody

Full Product Name

GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (MaxLight 650)

Product Gene Name

anti-GTF2A1 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2H5

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human GTF2A1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

32.2kDa (297aa) confirmed by MALDI-TOF

OMIM

600520

3D Structure

ModBase 3D Structure for P52655

Immunogen

Partial recombinant corresponding to aa1-63 from human GTF2A1 (NP_056943) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE

Conjugate

MaxLight650

Product Categories/Family for anti-GTF2A1 antibody

Antibodies; Translation Initiation Factors

Applications Tested/Suitable for anti-GTF2A1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-GTF2A1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-GTF2A1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GTF2A1 purchase

MBS6222476 is an antibody targeting GTF2A1. Also known as GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GTF2A1. It may not necessarily be applicable to this product.

NCBI GI #

7706735

NCBI GeneID

2957

NCBI Accession #

NP_056943

UniProt Primary Accession #

P52655

UniProt Secondary Accession #

Q3KNQ9

UniProt Related Accession #

P52655

GenBank Nucleotide #

NM_015859

NCBI Official Full Name

transcription initiation factor IIA subunit 1 isoform 1

NCBI Official Synonym Full Names

general transcription factor IIA subunit 1

NCBI Official Symbol

GTF2A1

NCBI Official Synonym Symbols

TF2A1; TFIIA; TFIIAL; TFIIA-42

UniProt Protein Name

Transcription initiation factor IIA subunit 1

UniProt Synonym Protein Names

General transcription factor IIA subunit 1; TFIIAL; Transcription initiation factor TFIIA 42 kDa subunit; TFIIA-42Cleaved into the following 2 chains:Transcription initiation factor IIA alpha chain; Alternative name(s):; TFIIA p35 subunitTranscription initiation factor IIA beta chain; Alternative name(s):; TFIIA p19 subunit

Protein Family

Transcription initiation factor

UniProt Gene Name

GTF2A1

UniProt Synonym Gene Names

TF2A1; TFIIA-42

UniProt Entry Name

TF2AA_HUMAN

NCBI Protein Information

transcription initiation factor IIA subunit 1

NCBI Summary for GTF2A1

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]

UniProt Comments for GTF2A1

GTF2A1: a general transcription factor that plays an important role in transcriptional activation. A component of the transcription machinery of RNA polymerase II. Phosphorylated by Taf(II) 250 on serines that regulate TBP binding. Interacts with TBP (the TATA-binding protein). Two isoforms, 42 kDa and 37 kDa, are produced by alternative initiation.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q31.1

Cellular Component: nucleoplasm; cytoplasm; transcription factor TFIIA complex

Molecular Function: protein binding; DNA binding; TATA-binding protein binding; protein heterodimerization activity; transcription coactivator activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; viral reproduction; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2A1

1. In a cohort of youth at risk for bipolar disorder, pathway analysis showed an enrichment of the glucocorticoid receptor (GR) pathway with the genes MED1, HSPA1L, GTF2A1 and TAF15, which might underlie the previously reported role of stress response in the risk for bipolar disorder in vulnerable populations.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GTF2A1 antibody

Reference Product	PubMed Publications
TBP antibody	>1 publications with GTF2A1 and TBP
GTF2A2 antibody	>1 publications with GTF2A1 and GTF2A2

Pathways associated with anti-GTF2A1 antibody

Products by Pathway	Pathway Diagram
Basal Transcription Factors Pathway antibodies	Basal Transcription Factors Pathway Diagram
Basal Transcription Factors Pathway antibodies	Basal Transcription Factors Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Gene Expression Pathway antibodies	Gene Expression Pathway Diagram
HIV Infection Pathway antibodies	HIV Infection Pathway Diagram
HIV Life Cycle Pathway antibodies	HIV Life Cycle Pathway Diagram
HIV Transcription Initiation Pathway antibodies	HIV Transcription Initiation Pathway Diagram
Infectious Disease Pathway antibodies	Infectious Disease Pathway Diagram
Late Phase Of HIV Life Cycle Pathway antibodies	Late Phase Of HIV Life Cycle Pathway Diagram
RNA Polymerase II HIV Promoter Escape Pathway antibodies	RNA Polymerase II HIV Promoter Escape Pathway Diagram

Diseases associated with anti-GTF2A1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>2 publications with GTF2A1 and Neoplasms
Ovarian Diseases Antibodies	>1 publications with GTF2A1 and Ovarian Diseases
Ovarian Neoplasms Antibodies	>1 publications with GTF2A1 and Ovarian Neoplasms

Organs/Tissues associated with anti-GTF2A1 antibody

Organ/Tissue Name	Pubmed Publications
Stomach Antibodies	>1 publications with GTF2A1 and Stomach
Testis Antibodies	>1 publications with GTF2A1 and Testis