• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

IL18RAP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6222735

Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
IL18RAP, Monoclonal Antibody
Full Product Name
IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7
Product Gene Name
anti-IL18RAP antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human IL18RAP.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
65.4kDa (576aa) 70-100KDa (SDS-PAGE under reducing conditions.)
OMIM
604509
3D Structure
ModBase 3D Structure for O95256
Immunogen
Partial recombinant corresponding to aa20-129 from IL18RAP (NP_003844) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
Conjugate
MaxLight650

Product Categories/Family for anti-IL18RAP antibody

Antibodies; Interleukin
Applications Tested/Suitable for anti-IL18RAP antibody
FLISA, Western Blot (WB)
Application Notes for anti-IL18RAP antibody
Applications are based on unconjugated antibody.

Product References and Citations for anti-IL18RAP antibody

1. Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis. Badot V, Galant C, Nzeusseu Toukap A, Theate I, Maudoux AL, Van den Eynde BJ, Durez P, Houssiau FA, Lauwerys BR.Arthritis Res Ther. 2009;11(2):R57. Epub 2009 Apr 23. 2. Association study of the IL18RAP locus in three European populations with coeliac disease. Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adany R, Pocsai Z, Szeles G, Maki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P.Hum Mol Genet. 2009 Mar 15;18(6):1148-55. Epub 2008 Dec 22.

Other Notes

Small volumes of anti-IL18RAP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IL18RAP purchase

MBS6222735 is an antibody targeting IL18RAP. Also known as IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for IL18RAP. It may not necessarily be applicable to this product.

NCBI GI #
4504657
NCBI GeneID
8807
NCBI Accession #
NP_003844
UniProt Primary Accession #
O95256
UniProt Secondary Accession #
Q2QDE5; Q3KPE7; Q3KPE8; Q53TT4; Q53TU5; B2RPJ3
UniProt Related Accession #
O95256
GenBank Nucleotide #
NM_003853
NCBI Official Full Name
interleukin-18 receptor accessory protein
NCBI Official Synonym Full Names
interleukin 18 receptor accessory protein
NCBI Official Symbol
IL18RAP
NCBI Official Synonym Symbols
ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
UniProt Protein Name
Interleukin-18 receptor accessory protein
UniProt Synonym Protein Names
Accessory protein-like; AcPL; CD218 antigen-like family member B; CDw218b; IL-1R accessory protein-like; IL-1RAcPL; Interleukin-1 receptor 7; IL-1R-7; IL-1R7; Interleukin-18 receptor accessory protein-like; Interleukin-18 receptor beta; IL-18R-beta; IL-18Rbeta; CD_antigen: CD218b
Protein Family
Interleukin-18 receptor accessory protein
UniProt Gene Name
IL18RAP
UniProt Synonym Gene Names
IL1R7; IL-18 receptor accessory protein; IL-18RAcP; AcPL; IL-1RAcPL; IL-1R-7; IL-1R7; IL-18R-beta; IL-18Rbeta
UniProt Entry Name
I18RA_HUMAN
NCBI Protein Information
interleukin-18 receptor accessory protein

NCBI Summary for IL18RAP

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]
Show more

UniProt Comments for IL18RAP

IL18RAP: Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. Belongs to the interleukin-1 receptor family.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane

Molecular Function: receptor activity

Biological Process: cell surface receptor linked signal transduction; immune response; inflammatory response
Show more

Research Articles on IL18RAP

1. These findings suggested that IL-18RAP rs917997, IL-32 rs2015620, IL-22 rs1179251, and interactions between these polymorphisms and H. pylori infection were associated with risks of gastric lesions

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IL18RAP antibody

 Reference Product  PubMed Publications
 IL18 antibody  >37 publications with IL18RAP and IL18
 IL18R1 antibody  >21 publications with IL18RAP and IL18R1
 CCR5 antibody  >2 publications with IL18RAP and CCR5
 IL13 antibody  >1 publications with IL18RAP and IL13
 IFNG antibody  >1 publications with IL18RAP and IFNG

Pathways associated with anti-IL18RAP antibody

 Products by Pathway  Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 IL12 Signaling Mediated By STAT4 Pathway antibodies  IL12 Signaling Mediated By STAT4 Pathway Diagram
 IL12-mediated Signaling Events Pathway antibodies  IL12-mediated Signaling Events Pathway Diagram
 IL23-mediated Signaling Events Pathway antibodies  IL23-mediated Signaling Events Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Inflammatory Bowel Disease (IBD) Pathway antibodies  Inflammatory Bowel Disease (IBD) Pathway Diagram
 Inflammatory Bowel Disease (IBD) Pathway antibodies  Inflammatory Bowel Disease (IBD) Pathway Diagram
 Signaling By Interleukins Pathway antibodies  Signaling By Interleukins Pathway Diagram

Diseases associated with anti-IL18RAP antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >11 publications with IL18RAP and Inflammation
 Autoimmune Diseases Antibodies  >10 publications with IL18RAP and Autoimmune Diseases
 Glucose Metabolism Disorders Antibodies  >8 publications with IL18RAP and Glucose Metabolism Disorders
 Inflammatory Bowel Diseases Antibodies  >7 publications with IL18RAP and Inflammatory Bowel Diseases
 Cardiovascular Diseases Antibodies  >6 publications with IL18RAP and Cardiovascular Diseases
 Heart Diseases Antibodies  >5 publications with IL18RAP and Heart Diseases
 Colitis Antibodies  >3 publications with IL18RAP and Colitis
 Colitis, Ulcerative Antibodies  >3 publications with IL18RAP and Colitis, Ulcerative
 Atherosclerosis Antibodies  >2 publications with IL18RAP and Atherosclerosis
 Necrosis Antibodies  >2 publications with IL18RAP and Necrosis

Organs/Tissues associated with anti-IL18RAP antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >22 publications with IL18RAP and Blood
 Brain Antibodies  >4 publications with IL18RAP and Brain
 Kidney Antibodies  >2 publications with IL18RAP and Kidney
 Thymus Antibodies  >1 publications with IL18RAP and Thymus
 Spleen Antibodies  >1 publications with IL18RAP and Spleen
 Liver Antibodies  >1 publications with IL18RAP and Liver
 Pancreas Antibodies  >1 publications with IL18RAP and Pancreas
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000