Mouse Anti-P2RX5 Monoclonal Antibody – Cat# MBS6223620

P2RX5 Antibody – Mouse Monoclonal

Name: P2RX5 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6223620
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6223620

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Several characteristic motifs of ATP-gated channels are present in its primary structure, but, unlike other members of the… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

P2RX5, Monoclonal Antibody

Full Product Name

P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (MaxLight 650)

Product Gene Name

anti-P2RX5 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1C5

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human P2RX5.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

602836

3D Structure

ModBase 3D Structure for Q93086

Immunogen

Partial recombinant corresponding to aa126-225 from human P2RX5 (NP_002552) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP

Conjugate

MaxLight650

Product Categories/Family for anti-P2RX5 antibody

Antibodies; Receptors

Applications Tested/Suitable for anti-P2RX5 antibody

FLISA, Western Blot (WB)

Application Notes for anti-P2RX5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-P2RX5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for P2RX5 purchase

MBS6223620 is an antibody targeting P2RX5. Also known as P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for P2RX5. It may not necessarily be applicable to this product.

NCBI GI #

28416933

NCBI GeneID

5026

NCBI Accession #

NP_002552

UniProt Primary Accession #

Q93086

UniProt Related Accession #

Q93086

GenBank Nucleotide #

NM_002561

NCBI Official Full Name

P2X purinoceptor 5 isoform A

NCBI Official Synonym Full Names

purinergic receptor P2X 5

NCBI Official Symbol

P2RX5

NCBI Official Synonym Symbols

P2X5; LRH-1; P2X5R

UniProt Protein Name

P2X purinoceptor 5

UniProt Synonym Protein Names

ATP receptor; Purinergic receptor

Protein Family

P2X purinoceptor

UniProt Gene Name

P2RX5

UniProt Synonym Gene Names

P2X5; P2X5

UniProt Entry Name

P2RX5_HUMAN

NCBI Protein Information

P2X purinoceptor 5

NCBI Summary for P2RX5

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3). [provided by RefSeq, Mar 2011]

UniProt Comments for P2RX5

P2X5: Receptor for ATP that acts as a ligand-gated ion channel. Belongs to the P2X receptor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: cytoplasm; integral to nuclear inner membrane; integral to plasma membrane; plasma membrane

Molecular Function: ATP binding; ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity; transmembrane receptor activity

Biological Process: blood coagulation; nervous system development; positive regulation of calcium-mediated signaling; response to ATP; signal transduction; transport

Research Articles on P2RX5

1. sensory proteins P2X3 and TRPV1 are in correlation with urothelial differentiation, while P2X5 and TRPV4 have unique expression patterns

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.