Mouse Anti-PNN Monoclonal Antibody – Cat# MBS6223922

PNN Antibody – Mouse Monoclonal

Name: PNN Antibody; Monoclonal; Mouse; Human/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6223922
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6223922

Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PNN, Monoclonal Antibody

Full Product Name

PNN (DRS, MEMA, Pinin, 140kD Nuclear and Cell Adhesion-related Phosphoprotein, Desmosome-associated Protein, Domain-rich Serine Protein, Melanoma Metastasis Clone A Protein, Nuclear Protein SDK3, SR-like Protein) (MaxLight 650)

Product Gene Name

anti-PNN antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2B4

Host

Mouse

Species Reactivity

Human, Rat

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human PNN. Species Crossreactivity: rat.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

81kDa

OMIM

603154

3D Structure

ModBase 3D Structure for Q9H307

Immunogen

Partial recombinant corresponding to aa201-301 from human PNN (NP_002678) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN

Conjugate

MaxLight650

Product Categories/Family for anti-PNN antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-PNN antibody

FLISA, Western Blot (WB)

Application Notes for anti-PNN antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PNN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PNN purchase

MBS6223922 is an antibody targeting PNN. Also known as PNN (DRS, MEMA, Pinin, 140kD Nuclear and Cell Adhesion-related Phosphoprotein, Desmosome-associated Protein, Domain-rich Serine Protein, Melanoma Metastasis Clone A Protein, Nuclear Protein SDK3, SR-like Protein) (MaxLight 650). Reactive in Human, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PNN. It may not necessarily be applicable to this product.

NCBI GI #

1519314785

NCBI GeneID

5411

NCBI Accession #

NP_002678

UniProt Primary Accession #

Q9H307

UniProt Related Accession #

Q9H307

GenBank Nucleotide #

NM_002687

NCBI Official Full Name

pinin

NCBI Official Synonym Full Names

pinin, desmosome associated protein

NCBI Official Symbol

PNN

NCBI Official Synonym Symbols

DRS; DRSP; SDK3; memA

UniProt Protein Name

Pinin

UniProt Synonym Protein Names

140 kDa nuclear and cell adhesion-related phosphoprotein; Desmosome-associated protein; Domain-rich serine protein; DRS protein; DRSP; Melanoma metastasis clone A protein; Nuclear protein SDK3; SR-like protein

Protein Family

Pinin

UniProt Gene Name

PNN

UniProt Synonym Gene Names

DRS; MEMA; DRS protein; DRSP

UniProt Entry Name

PININ_HUMAN

NCBI Protein Information

pinin

UniProt Comments for PNN

PNN: Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. Capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Participates in the regulation of alternative pre-mRNA splicing. Associates to spliced mRNA within 60 nt upstream of the 5'-splice sites. Involved in the establishment and maintenance of epithelia cell-cell adhesion. Potential tumor suppressor for renal cell carcinoma. Belongs to the pinin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Spliceosome; RNA-binding; RNA splicing; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q21.1

Cellular Component: nucleoplasm; desmosome; membrane; cytoplasm; plasma membrane; intermediate filament; nuclear speck; intercellular junction

Molecular Function: DNA binding; structural molecule activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of transcription, DNA-dependent; cell adhesion

Research Articles on PNN

1. Data suggest that SNRPA1, SNRPD1, and PNN are key players in the regulation of pluripotency-specific spliceosome assembly and the acquisition and maintenance of pluripotency.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.