Mouse Anti-POFUT1 Monoclonal Antibody – Cat# MBS6223924

POFUT1 Antibody – Mouse Monoclonal

Name: POFUT1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6223924
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6223924

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

POFUT1, Monoclonal Antibody

Full Product Name

POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (MaxLight 650)

Product Gene Name

anti-POFUT1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3H1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human POFUT1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

607491

3D Structure

ModBase 3D Structure for Q9H488

Immunogen

Partial recombinant corresponding to aa85-195 from POFUT1 (NP_758436) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

VSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR*

Conjugate

MaxLight650

Product Categories/Family for anti-POFUT1 antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-POFUT1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-POFUT1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-POFUT1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for POFUT1 purchase

MBS6223924 is an antibody targeting POFUT1. Also known as POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for POFUT1. It may not necessarily be applicable to this product.

NCBI GI #

27436891

NCBI GeneID

23509

NCBI Accession #

NP_758436

UniProt Primary Accession #

Q9H488

UniProt Related Accession #

Q9H488

GenBank Nucleotide #

NM_172236

NCBI Official Full Name

GDP-fucose protein O-fucosyltransferase 1 isoform 2

NCBI Official Synonym Full Names

protein O-fucosyltransferase 1

NCBI Official Symbol

POFUT1

NCBI Official Synonym Symbols

DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1

UniProt Protein Name

GDP-fucose protein O-fucosyltransferase 1

UniProt Synonym Protein Names

Peptide-O-fucosyltransferase 1

UniProt Gene Name

POFUT1

UniProt Synonym Gene Names

FUT12; KIAA0180; O-FucT-1

UniProt Entry Name

OFUT1_HUMAN

NCBI Protein Information

GDP-fucose protein O-fucosyltransferase 1

NCBI Summary for POFUT1

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

UniProt Comments for POFUT1

POFUT1: Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains. Plays a crucial role in Notch signaling. Belongs to the glycosyltransferase 68 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.1.221; Transferase

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: membrane; endoplasmic reticulum

Molecular Function: peptide-O-fucosyltransferase activity; fucosyltransferase activity

Biological Process: fucose metabolic process; nervous system development; protein amino acid O-linked glycosylation; somitogenesis; embryonic development; Notch signaling pathway; regulation of transcription, DNA-dependent; O-glycan processing; heart development; angiogenesis

Disease: Dowling-degos Disease 2

Research Articles on POFUT1

1. PLAGL2 and POFUT1 were common and upregulated in tumor samples in colorectal cancer (CRC). Survival analysis of PLAGL2 and POFUT1 expression revealed differences between proximal and distal CRC. PLAGL2 and POFUT1, which have the highest correlation with tumor location, may serve as biomarkers and therapeutic targets for the precise diagnosis and treatment of CRC in the future.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.