Mouse Anti-RAET1E Monoclonal Antibody – Cat# MBS6224187

RAET1E Antibody – Mouse Monoclonal

Name: RAET1E Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6224187
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6224187

MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RAET1E, Monoclonal Antibody

Full Product Name

RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 650)

Product Gene Name

anti-RAET1E antibody

Product Synonym Names

bA350J20.7; MGC125308; MGC125309; RAET1E2

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2D11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RAET1E.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

32,300 Da

OMIM

609243

3D Structure

ModBase 3D Structure for Q8TD07

Immunogen

Partial recombinant protein corresponding to aa36-146 from human RAET1E (NP_631904) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

NFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGE

Conjugate

MaxLight650

Product Categories/Family for anti-RAET1E antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-RAET1E antibody

FLISA

Application Notes for anti-RAET1E antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RAET1E antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RAET1E purchase

MBS6224187 is an antibody targeting RAET1E. Also known as RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RAET1E. It may not necessarily be applicable to this product.

NCBI GI #

21040249

NCBI GeneID

135250

NCBI Accession #

NP_631904.1

UniProt Primary Accession #

Q8TD07

UniProt Secondary Accession #

Q5VYB7; Q5VYB8; Q8TEZ2; Q96L41; A6YF59

UniProt Related Accession #

Q8TD07

GenBank Nucleotide #

NM_139165

NCBI Official Full Name

retinoic acid early transcript 1E isoform 1

NCBI Official Synonym Full Names

retinoic acid early transcript 1E

NCBI Official Symbol

RAET1E

NCBI Official Synonym Symbols

RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7

UniProt Protein Name

NKG2D ligand 4

UniProt Synonym Protein Names

Lymphocyte effector toxicity activation ligand; RAE-1-like transcript 4; RL-4; Retinoic acid early transcript 1E

Protein Family

NKG2D ligand

UniProt Gene Name

RAET1E

UniProt Synonym Gene Names

LETAL; N2DL4; ULBP4; N2DL-4; NKG2DL4; RL-4

UniProt Entry Name

N2DL4_HUMAN

NCBI Protein Information

retinoic acid early transcript 1E

NCBI Summary for RAET1E

This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. This protein functions as a ligand for NKG2D receptor, which is expressed on the surface of several types of immune cells, and is involved in innate and adaptive immune responses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2011]

UniProt Comments for RAET1E

RAET1E: Ligand for the NKG2D receptor. Delivers activating signals to NK cells and promotes tumor immune surveillance by inducing the expansion of anti-tumor cytotoxic lymphocytes. Belongs to the MHC class I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: plasma membrane

Molecular Function: antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; natural killer cell mediated cytotoxicity; regulation of immune response; T cell mediated cytotoxicity

Research Articles on RAET1E

1. decreased expression levels of ULBP4 in NPC tissues as compared to that in normal NP epithelial tissues. In addition, low ULBP4 expression correlated with poor OS, DFS, DMFS, and may prove to be a novel prognostic factor.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-RAET1E antibody

Products by Pathway	Pathway Diagram
Adaptive Immune System Pathway antibodies	Adaptive Immune System Pathway Diagram
Immune System Pathway antibodies	Immune System Pathway Diagram
Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway antibodies	Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway Diagram
Natural Killer Cell Mediated Cytotoxicity Pathway antibodies	Natural Killer Cell Mediated Cytotoxicity Pathway Diagram
Natural Killer Cell Mediated Cytotoxicity Pathway antibodies	Natural Killer Cell Mediated Cytotoxicity Pathway Diagram

Diseases associated with anti-RAET1E antibody

Disease Name	Pubmed Publications
Disease Models, Animal Antibodies	>3 publications with RAET1E and Disease Models, Animal
Neoplasms, Experimental Antibodies	>3 publications with RAET1E and Neoplasms, Experimental
Atherosclerosis Antibodies	>2 publications with RAET1E and Atherosclerosis
Liver Neoplasms Antibodies	>1 publications with RAET1E and Liver Neoplasms
Brain Diseases Antibodies	>1 publications with RAET1E and Brain Diseases
Liver Diseases Antibodies	>1 publications with RAET1E and Liver Diseases
Carcinoma, Hepatocellular Antibodies	>1 publications with RAET1E and Carcinoma, Hepatocellular
Heart Diseases Antibodies	>1 publications with RAET1E and Heart Diseases
Necrosis Antibodies	>1 publications with RAET1E and Necrosis
Nervous System Diseases Antibodies	>1 publications with RAET1E and Nervous System Diseases

Organs/Tissues associated with anti-RAET1E antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>15 publications with RAET1E and Blood
Vascular Antibodies	>2 publications with RAET1E and Vascular
Liver Antibodies	>2 publications with RAET1E and Liver
Larynx Antibodies	>1 publications with RAET1E and Larynx
Cervix Antibodies	>1 publications with RAET1E and Cervix
Stomach Antibodies	>1 publications with RAET1E and Stomach
Heart Antibodies	>1 publications with RAET1E and Heart
Skin Antibodies	>1 publications with RAET1E and Skin
Uterus Antibodies	>1 publications with RAET1E and Uterus
Brain Antibodies	>1 publications with RAET1E and Brain