Mouse Anti-DUSP5 Monoclonal Antibody – Cat# MBS6227308

DUSP5 Antibody – Mouse Monoclonal

Name: DUSP5 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6227308
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6227308

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DUSP5, Monoclonal Antibody

Full Product Name

DUSP5 (Dual Specificity Phosphatase 5, DUSP, HVH3) (MaxLight 650)

Product Gene Name

anti-DUSP5 antibody

Product Synonym Names

Dual Specificity Phosphatase 5; DUSP; HVH3

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

2F3

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified

Specificity

Recognizes DUSP5.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

42kDa

OMIM

603069

3D Structure

ModBase 3D Structure for Q16690

Immunogen

DUSP5 (NP_004410, 286aa-384aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC

Conjugate

MaxLight650

Product Categories/Family for anti-DUSP5 antibody

Antibodies; Enzymes; Phosphatase

Applications Tested/Suitable for anti-DUSP5 antibody

Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-DUSP5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DUSP5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DUSP5 purchase

MBS6227308 is an antibody targeting DUSP5. Also known as DUSP5 (Dual Specificity Phosphatase 5, DUSP, HVH3) (MaxLight 650). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DUSP5. It may not necessarily be applicable to this product.

NCBI GI #

62865890

NCBI GeneID

1847

NCBI Accession #

NP_004410

UniProt Primary Accession #

Q16690

UniProt Related Accession #

Q16690

GenBank Nucleotide #

NM_004419

NCBI Official Full Name

dual specificity protein phosphatase 5

NCBI Official Synonym Full Names

dual specificity phosphatase 5

NCBI Official Symbol

DUSP5

NCBI Official Synonym Symbols

DUSP; HVH3

UniProt Protein Name

Dual specificity protein phosphatase 5

UniProt Synonym Protein Names

Dual specificity protein phosphatase hVH3

Protein Family

Dual specificity protein phosphatase

UniProt Gene Name

DUSP5

UniProt Synonym Gene Names

VH3

UniProt Entry Name

DUS5_HUMAN

NCBI Protein Information

dual specificity protein phosphatase 5

UniProt Comments for DUSP5

Function: Displays phosphatase activity toward several substrates. The highest relative activity is toward ERK1.

Catalytic activity: Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.A phosphoprotein + H2O = a protein + phosphate.

Subcellular location: Nucleus

Potential.

Sequence similarities: Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 rhodanese domain.Contains 1 tyrosine-protein phosphatase domain.

Research Articles on DUSP5

1. Data show that dual specificity phosphatase 5 (DUSP5) is a downstream target of p68 RNA helicase (p68).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DUSP5 antibody

Reference Product	PubMed Publications
MAPK3 antibody	>12 publications with DUSP5 and MAPK3
MAPK1 antibody	>12 publications with DUSP5 and MAPK1
SNRK antibody	>1 publications with DUSP5 and SNRK
MAPK8 antibody	>1 publications with DUSP5 and MAPK8
TP53 antibody	>1 publications with DUSP5 and TP53

Pathways associated with anti-DUSP5 antibody

Products by Pathway	Pathway Diagram
ATF-2 Transcription Factor Network Pathway antibodies	ATF-2 Transcription Factor Network Pathway Diagram
Direct P53 Effectors Pathway antibodies	Direct P53 Effectors Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram

Diseases associated with anti-DUSP5 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>14 publications with DUSP5 and Neoplasms
Necrosis Antibodies	>4 publications with DUSP5 and Necrosis
Cardiovascular Diseases Antibodies	>3 publications with DUSP5 and Cardiovascular Diseases
Inflammation Antibodies	>3 publications with DUSP5 and Inflammation
Nervous System Diseases Antibodies	>2 publications with DUSP5 and Nervous System Diseases
Kidney Diseases Antibodies	>2 publications with DUSP5 and Kidney Diseases
Neoplasms, Experimental Antibodies	>2 publications with DUSP5 and Neoplasms, Experimental
Breast Neoplasms Antibodies	>2 publications with DUSP5 and Breast Neoplasms
Hyperplasia Antibodies	>2 publications with DUSP5 and Hyperplasia
Brain Diseases Antibodies	>2 publications with DUSP5 and Brain Diseases

Organs/Tissues associated with anti-DUSP5 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>14 publications with DUSP5 and Blood
Brain Antibodies	>8 publications with DUSP5 and Brain
Kidney Antibodies	>5 publications with DUSP5 and Kidney
Nerve Antibodies	>3 publications with DUSP5 and Nerve
Embryonic Tissue Antibodies	>3 publications with DUSP5 and Embryonic Tissue
Liver Antibodies	>3 publications with DUSP5 and Liver
Eye Antibodies	>2 publications with DUSP5 and Eye
Lung Antibodies	>2 publications with DUSP5 and Lung
Thyroid Antibodies	>2 publications with DUSP5 and Thyroid
Muscle Antibodies	>2 publications with DUSP5 and Muscle