• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CDO1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6232088

Cysteine dioxygenase (CDO1) is a mammalian non-heme iron enzyme that initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. This protein catalyzes the conversion of… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CDO1, Monoclonal Antibody
Full Product Name
CDO1 (Cysteine Dioxygenase Type 1, Cysteine Dioxygenase Type I, CDO, CDO-I) (MaxLight 750)
Product Gene Name
anti-CDO1 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CDO1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
22,972 Da
OMIM
603943
3D Structure
ModBase 3D Structure for Q16878
Immunogen
Partial recombinant corresponding to aa101-200 from human CDO1 (NP_001792.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Conjugate
MaxLight750

Product Categories/Family for anti-CDO1 antibody

Antibodies; Enzymes; Oxidase
Applications Tested/Suitable for anti-CDO1 antibody
FLISA, Western Blot (WB)
Application Notes for anti-CDO1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CDO1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CDO1 purchase

MBS6232088 is an antibody targeting CDO1. Also known as CDO1 (Cysteine Dioxygenase Type 1, Cysteine Dioxygenase Type I, CDO, CDO-I) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CDO1. It may not necessarily be applicable to this product.

NCBI GI #
56786147
NCBI GeneID
1036
NCBI Accession #
NP_001792.2
UniProt Primary Accession #
Q16878
UniProt Secondary Accession #
P78513; Q6FHZ8; Q8TB64; B2RAK4
UniProt Related Accession #
Q16878
GenBank Nucleotide #
NM_001801
NCBI Official Full Name
cysteine dioxygenase type 1
NCBI Official Synonym Full Names
cysteine dioxygenase type 1
NCBI Official Symbol
CDO1
UniProt Protein Name
Cysteine dioxygenase type 1
UniProt Synonym Protein Names
Cysteine dioxygenase type I; CDO; CDO-I
Protein Family
Cysteine dioxygenase
UniProt Gene Name
CDO1
UniProt Synonym Gene Names
CDO; CDO-I
UniProt Entry Name
CDO1_HUMAN
NCBI Protein Information
cysteine dioxygenase type 1; CDO; CDO-I; cysteine dioxygenase, type I

UniProt Comments for CDO1

CDO1: Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range. Belongs to the cysteine dioxygenase family.

Protein type: Other Amino Acids Metabolism - taurine and hypotaurine; Oxidoreductase; EC 1.13.11.20; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: cytosol

Molecular Function: cysteine dioxygenase activity; ferrous iron binding

Biological Process: lactation; cysteine metabolic process; sulfur amino acid biosynthetic process; response to ethanol; response to cAMP; response to glucagon stimulus; sulfur amino acid metabolic process; sulfur amino acid catabolic process; response to glucocorticoid stimulus; taurine biosynthetic process; inflammatory response; response to amino acid stimulus; L-cysteine catabolic process
Show more

Research Articles on CDO1

1. A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CDO1 antibody

 Reference Product  PubMed Publications
 CTH antibody  >1 publications with CDO1 and CTH

Pathways associated with anti-CDO1 antibody

 Products by Pathway  Pathway Diagram
 Cysteine And Methionine Metabolism Pathway antibodies  Cysteine And Methionine Metabolism Pathway Diagram
 Cysteine And Methionine Metabolism Pathway antibodies  Cysteine And Methionine Metabolism Pathway Diagram
 Degradation Of Cysteine And Homocysteine Pathway antibodies  Degradation Of Cysteine And Homocysteine Pathway Diagram
 L-cysteine Degradation I Pathway antibodies  L-cysteine Degradation I Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Amino Acids And Derivatives Pathway antibodies  Metabolism Of Amino Acids And Derivatives Pathway Diagram
 Sulfur Amino Acid Metabolism Pathway antibodies  Sulfur Amino Acid Metabolism Pathway Diagram
 Taurine And Hypotaurine Metabolism Pathway antibodies  Taurine And Hypotaurine Metabolism Pathway Diagram
 Taurine And Hypotaurine Metabolism Pathway antibodies  Taurine And Hypotaurine Metabolism Pathway Diagram

Diseases associated with anti-CDO1 antibody

 Disease Name  Pubmed Publications
 Lung Neoplasms Antibodies  >4 publications with CDO1 and Lung Neoplasms
 Breast Neoplasms Antibodies  >4 publications with CDO1 and Breast Neoplasms
 Inflammation Antibodies  >3 publications with CDO1 and Inflammation
 Liver Cirrhosis Antibodies  >2 publications with CDO1 and Liver Cirrhosis
 Liver Diseases Antibodies  >2 publications with CDO1 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >2 publications with CDO1 and Carcinoma, Hepatocellular
 Brain Diseases Antibodies  >2 publications with CDO1 and Brain Diseases
 Hepatitis Antibodies  >1 publications with CDO1 and Hepatitis
 Disease Models, Animal Antibodies  >1 publications with CDO1 and Disease Models, Animal
 Kidney Diseases Antibodies  >1 publications with CDO1 and Kidney Diseases

Organs/Tissues associated with anti-CDO1 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >7 publications with CDO1 and Liver
 Lung Antibodies  >5 publications with CDO1 and Lung
 Lymph Node Antibodies  >2 publications with CDO1 and Lymph Node
 Brain Antibodies  >2 publications with CDO1 and Brain
 Prostate Antibodies  >1 publications with CDO1 and Prostate
 Kidney Antibodies  >1 publications with CDO1 and Kidney
 Adipose Tissue Antibodies  >1 publications with CDO1 and Adipose Tissue
 Heart Antibodies  >1 publications with CDO1 and Heart
 Embryonic Tissue Antibodies  >1 publications with CDO1 and Embryonic Tissue
 Eye Antibodies  >1 publications with CDO1 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000