• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EPHB6 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6232712

MBS6232712 is an antibody targeting EPHB6. Also known as EPHB6 (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP) (MaxLight 750). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EPHB6, Monoclonal Antibody
Full Product Name
EPHB6 (Ephrin Type-A Receptor 6, Tyrosine-protein Kinase Receptor EPH-6, HEP) (MaxLight 750)
Product Gene Name
anti-EPHB6 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D8
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EPHB6. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
57,498 Da
OMIM
602757
3D Structure
ModBase 3D Structure for O15197
Immunogen
Partial recombinant corresponding to aa23-122 from EPHB6 (NP_004436) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
Conjugate
MaxLight750

Product Categories/Family for anti-EPHB6 antibody

Antibodies; Tyrosine Kinases
Applications Tested/Suitable for anti-EPHB6 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-EPHB6 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-EPHB6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EPHB6. It may not necessarily be applicable to this product.

NCBI GI #
615276335
NCBI GeneID
2051
NCBI Accession #
NP_004436
UniProt Primary Accession #
O15197
UniProt Secondary Accession #
Q2TB23; Q2TB24; A4D2I7; A8CDT5; D3DXD3
UniProt Related Accession #
O15197
GenBank Nucleotide #
NM_004445
NCBI Official Full Name
ephrin type-B receptor 6 isoform a
NCBI Official Synonym Full Names
EPH receptor B6
NCBI Official Symbol
EPHB6
NCBI Official Synonym Symbols
HEP
UniProt Protein Name
Ephrin type-B receptor 6
UniProt Synonym Protein Names
HEP; Tyrosine-protein kinase-defective receptor EPH-6
Protein Family
Ephrin type-B receptor
UniProt Gene Name
EPHB6
UniProt Entry Name
EPHB6_HUMAN
NCBI Protein Information
ephrin type-B receptor 6; human kinase-defective Eph-family receptor protein; tyrosine-protein kinase-defective receptor EPH-6

UniProt Comments for EPHB6

EphB6: Kinase-defective receptor for members of the ephrin-B family. Binds to ephrin-B1 and ephrin-B2. Modulates cell adhesion and migration by exerting both positive and negative effects upon stimulation with ephrin-B2. Inhibits JNK activation, T-cell receptor-induced IL-2 secretion and CD25 expression upon stimulation with ephrin-B2. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, tyrosine (receptor); Kinase, protein; Protein kinase, TK; Membrane protein, integral; EC 2.7.10.1; TK group; Eph family

Chromosomal Location of Human Ortholog: 7q33-q35

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region; cytosol

Molecular Function: ephrin receptor activity; receptor activity; ATP binding

Biological Process: axon guidance; ephrin receptor signaling pathway; protein amino acid phosphorylation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EPHB6 antibody

 Reference Product  PubMed Publications
 EFNB3 antibody  >9 publications with EPHB6 and EFNB3
 EFNB2 antibody  >8 publications with EPHB6 and EFNB2
 CBL antibody  >3 publications with EPHB6 and CBL
 EFNB1 antibody  >3 publications with EPHB6 and EFNB1
 PDGFRB antibody  >2 publications with EPHB6 and PDGFRB
 EFNA1 antibody  >2 publications with EPHB6 and EFNA1
 EFNA5 antibody  >1 publications with EPHB6 and EFNA5
 EFNA3 antibody  >1 publications with EPHB6 and EFNA3

Pathways associated with anti-EPHB6 antibody

 Products by Pathway  Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 EPH-Ephrin Signaling Pathway antibodies  EPH-Ephrin Signaling Pathway Diagram
 EPH-ephrin Mediated Repulsion Of Cells Pathway antibodies  EPH-ephrin Mediated Repulsion Of Cells Pathway Diagram
 EPHB-mediated Forward Signaling Pathway antibodies  EPHB-mediated Forward Signaling Pathway Diagram
 Ephrin Signaling Pathway antibodies  Ephrin Signaling Pathway Diagram

Diseases associated with anti-EPHB6 antibody

 Disease Name  Pubmed Publications
 Breast Neoplasms Antibodies  >11 publications with EPHB6 and Breast Neoplasms
 Lung Neoplasms Antibodies  >11 publications with EPHB6 and Lung Neoplasms
 Nervous System Diseases Antibodies  >6 publications with EPHB6 and Nervous System Diseases
 Brain Diseases Antibodies  >5 publications with EPHB6 and Brain Diseases
 Neoplasms, Experimental Antibodies  >4 publications with EPHB6 and Neoplasms, Experimental
 Liver Neoplasms Antibodies  >3 publications with EPHB6 and Liver Neoplasms
 Disease Models, Animal Antibodies  >2 publications with EPHB6 and Disease Models, Animal
 Pancreatic Neoplasms Antibodies  >2 publications with EPHB6 and Pancreatic Neoplasms
 Immune System Diseases Antibodies  >2 publications with EPHB6 and Immune System Diseases
 Cardiovascular Diseases Antibodies  >2 publications with EPHB6 and Cardiovascular Diseases

Organs/Tissues associated with anti-EPHB6 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >18 publications with EPHB6 and Blood
 Lung Antibodies  >12 publications with EPHB6 and Lung
 Brain Antibodies  >10 publications with EPHB6 and Brain
 Thymus Antibodies  >7 publications with EPHB6 and Thymus
 Bone Antibodies  >6 publications with EPHB6 and Bone
 Liver Antibodies  >5 publications with EPHB6 and Liver
 Embryonic Tissue Antibodies  >5 publications with EPHB6 and Embryonic Tissue
 Kidney Antibodies  >4 publications with EPHB6 and Kidney
 Lymph Node Antibodies  >3 publications with EPHB6 and Lymph Node
 Muscle Antibodies  >2 publications with EPHB6 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000