Mouse Anti-IFT20 Monoclonal Antibody – Cat# MBS6233386

IFT20 Antibody – Mouse Monoclonal

Name: IFT20 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6233386
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6233386

IFT20 is part of intraflagellar transport (IFT) particles involved in ciliary process assembly. IFT20 may play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

IFT20, Monoclonal Antibody

Full Product Name

IFT20 (Intraflagellar Transport Protein 20 Homolog) (MaxLight 750)

Product Gene Name

anti-IFT20 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3F3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human IFT20.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

614394

3D Structure

ModBase 3D Structure for Q8IY31

Immunogen

Full length recombinant corresponding to aa1-148 from human IFT20 (NP_777547) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKENAARKVSG

Conjugate

MaxLight750

Product Categories/Family for anti-IFT20 antibody

Antibodies; Transport Proteins

Applications Tested/Suitable for anti-IFT20 antibody

FLISA, Western Blot (WB)

Application Notes for anti-IFT20 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-IFT20 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IFT20 purchase

MBS6233386 is an antibody targeting IFT20. Also known as IFT20 (Intraflagellar Transport Protein 20 Homolog) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for IFT20. It may not necessarily be applicable to this product.

NCBI GI #

28372523

NCBI GeneID

90410

NCBI Accession #

NP_777547.1

UniProt Primary Accession #

Q8IY31

UniProt Related Accession #

Q8IY31

GenBank Nucleotide #

NM_174887

NCBI Official Full Name

intraflagellar transport protein 20 homolog isoform 2

NCBI Official Synonym Full Names

intraflagellar transport 20

NCBI Official Symbol

IFT20

UniProt Protein Name

Intraflagellar transport protein 20 homolog

Protein Family

Intraflagellar transport protein

UniProt Gene Name

IFT20

UniProt Synonym Gene Names

hIFT20

UniProt Entry Name

IFT20_HUMAN

NCBI Protein Information

intraflagellar transport protein 20 homolog

NCBI Summary for IFT20

This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.[provided by RefSeq, Jun 2012]

UniProt Comments for IFT20

IFT20: Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: centriole; microtubule cytoskeleton; Golgi membrane; Golgi apparatus; centrosome; photoreceptor outer segment; photoreceptor connecting cilium; cilium

Molecular Function: protein binding; opsin binding

Biological Process: smoothened signaling pathway; centrosome localization; organelle organization and biogenesis; protein localization in Golgi apparatus; intraflagellar transport; cilium biogenesis; visual learning; kidney development; cardiac muscle cell differentiation

Research Articles on IFT20

1. These results indicate that IFT20 plays an important role in collective invasion of CRC cells by regulating organization of Golgi-associated, stabilized microtubules and Golgi polarity in leader cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.