• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ILKAP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6233432

MBS6233432 is an antibody targeting ILKAP. Also known as ILKAP (Integrin-linked Kinase-associated Serine/Threonine Phosphatase 2C, DKFZp434J2031, FLJ10181, MGC4846) (MaxLight 750). Reactive in Human. Host: Mouse. More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ILKAP, Monoclonal Antibody
Full Product Name
ILKAP (Integrin-linked Kinase-associated Serine/Threonine Phosphatase 2C, DKFZp434J2031, FLJ10181, MGC4846) (MaxLight 750)
Product Gene Name
anti-ILKAP antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ILKAP.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
42,907 Da
3D Structure
ModBase 3D Structure for Q9H0C8
Immunogen
Partial recombinant corresponding to aa293-393 from human ILKAP (NP_110395) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
Conjugate
MaxLight750

Product Categories/Family for anti-ILKAP antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-ILKAP antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-ILKAP antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ILKAP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ILKAP. It may not necessarily be applicable to this product.

NCBI GI #
13540531
NCBI GeneID
80895
NCBI Accession #
NP_110395
UniProt Primary Accession #
Q9H0C8
UniProt Secondary Accession #
B3KM39
UniProt Related Accession #
Q9H0C8
GenBank Nucleotide #
NM_030768
NCBI Official Full Name
integrin-linked kinase-associated serine/threonine phosphatase 2C
NCBI Official Synonym Full Names
integrin-linked kinase-associated serine/threonine phosphatase
NCBI Official Symbol
ILKAP
NCBI Official Synonym Symbols
ILKAP2; ILKAP3; PP2C-DELTA
UniProt Protein Name
Integrin-linked kinase-associated serine/threonine phosphatase 2C
Protein Family
Integrin-linked kinase-associated serine/threonine phosphatase
UniProt Gene Name
ILKAP
UniProt Synonym Gene Names
ILKAP
UniProt Entry Name
ILKAP_HUMAN
NCBI Protein Information
integrin-linked kinase-associated serine/threonine phosphatase 2C; integrin-linked kinase associated phosphatase; protein phosphatase 2c, delta isozyme

UniProt Comments for ILKAP

ILKAP: a protein serine/threonine phosphatase of the PP2C family. Can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: cytoplasm

Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: protein amino acid dephosphorylation; regulation of DNA replication during S phase
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ILKAP antibody

 Reference Product  PubMed Publications
 ILK antibody  >4 publications with ILKAP and ILK

Diseases associated with anti-ILKAP antibody

 Disease Name  Pubmed Publications
 Ataxia Antibodies  >1 publications with ILKAP and Ataxia
 Nervous System Diseases Antibodies  >1 publications with ILKAP and Nervous System Diseases

Organs/Tissues associated with anti-ILKAP antibody

 Organ/Tissue Name  Pubmed Publications
 Mouth Antibodies  >2 publications with ILKAP and Mouth
 Blood Antibodies  >2 publications with ILKAP and Blood
 Prostate Antibodies  >1 publications with ILKAP and Prostate
 Kidney Antibodies  >1 publications with ILKAP and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000