• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NUMA1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6234246

NuMA (nuclear mitotic apparatus) is a long coil-coiled protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NUMA1, Monoclonal Antibody
Full Product Name
NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA) (MaxLight 750)
Product Gene Name
anti-NUMA1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NUMA1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
109,279 Da
OMIM
164009
3D Structure
ModBase 3D Structure for Q14980
Immunogen
Partial recombinant corresponding to aa200-307 from human NUMA1 (NP_006176) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK
Conjugate
MaxLight750

Product Categories/Family for anti-NUMA1 antibody

Antibodies; Nuclear Proteins
Applications Tested/Suitable for anti-NUMA1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-NUMA1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NUMA1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NUMA1 purchase

MBS6234246 is an antibody targeting NUMA1. Also known as NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NUMA1. It may not necessarily be applicable to this product.

NCBI GI #
71361682
NCBI GeneID
4926
NCBI Accession #
NP_006176
UniProt Primary Accession #
Q14980
UniProt Secondary Accession #
Q14981; Q9BTE9; H0YH75
UniProt Related Accession #
Q14980
GenBank Nucleotide #
NM_006185
NCBI Official Full Name
nuclear mitotic apparatus protein 1 isoform 1
NCBI Official Synonym Full Names
nuclear mitotic apparatus protein 1
NCBI Official Symbol
NUMA1
NCBI Official Synonym Symbols
NUMA; NMP-22
UniProt Protein Name
Nuclear mitotic apparatus protein 1
UniProt Synonym Protein Names
SP-H antigen
Protein Family
Nuclear mitotic apparatus protein
UniProt Gene Name
NUMA1
UniProt Synonym Gene Names
NUMA; NuMA protein
UniProt Entry Name
NUMA1_HUMAN
NCBI Protein Information
nuclear mitotic apparatus protein 1; SP-H antigen; centrophilin stabilizes mitotic spindle in mitotic cells; nuclear matrix protein-22; structural nuclear protein

UniProt Comments for NUMA1

NuMA-1: a coiled-coil nuclear protein that is required to establish and maintain mammalian spindle poles. Dissociates from condensing chromosomes during early prophase, before the complete disintegration of the nuclear lamina. As mitosis progresses it reassociates with telophase chromosomes very early during nuclear reformation, before substantial accumulation of lamins on chromosomal surfaces is evident. Two human splice-variant isoforms have been described.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: spindle pole; nuclear matrix; dendrite; chromosome; cytosol; nucleoplasm; Golgi membrane; cell soma; apical part of cell; spindle microtubule; cytoplasm; spindle; nucleus

Molecular Function: protein binding; microtubule binding; structural molecule activity

Biological Process: mitosis; meiotic cell cycle; establishment of mitotic spindle orientation; cell division; mitotic cell cycle; G2/M transition of mitotic cell cycle; nuclear organization and biogenesis

Disease: Acute Promyelocytic Leukemia
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NUMA1 antibody

 Reference Product  PubMed Publications
 GPSM2 antibody  >10 publications with NUMA1 and GPSM2
 TNKS antibody  >5 publications with NUMA1 and TNKS
 EPB41L2 antibody  >3 publications with NUMA1 and EPB41L2
 YEATS4 antibody  >2 publications with NUMA1 and YEATS4
 EPB41L1 antibody  >2 publications with NUMA1 and EPB41L1
 RAD21 antibody  >1 publications with NUMA1 and RAD21
 PIM1 antibody  >1 publications with NUMA1 and PIM1

Pathways associated with anti-NUMA1 antibody

 Products by Pathway  Pathway Diagram
 Caspase Cascade In Apoptosis Pathway antibodies  Caspase Cascade In Apoptosis Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Centrosome Maturation Pathway antibodies  Centrosome Maturation Pathway Diagram
 G2/M Transition Pathway antibodies  G2/M Transition Pathway Diagram
 Mitotic G2-G2/M Phases Pathway antibodies  Mitotic G2-G2/M Phases Pathway Diagram
 Recruitment Of NuMA To Mitotic Centrosomes Pathway antibodies  Recruitment Of NuMA To Mitotic Centrosomes Pathway Diagram
 Recruitment Of Mitotic Centrosome Proteins And Complexes Pathway antibodies  Recruitment Of Mitotic Centrosome Proteins And Complexes Pathway Diagram

Diseases associated with anti-NUMA1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >39 publications with NUMA1 and Neoplasms
 Breast Neoplasms Antibodies  >9 publications with NUMA1 and Breast Neoplasms
 Nervous System Diseases Antibodies  >6 publications with NUMA1 and Nervous System Diseases
 Prostatic Diseases Antibodies  >4 publications with NUMA1 and Prostatic Diseases
 Prostatic Neoplasms Antibodies  >4 publications with NUMA1 and Prostatic Neoplasms
 Brain Diseases Antibodies  >4 publications with NUMA1 and Brain Diseases
 Ovarian Diseases Antibodies  >2 publications with NUMA1 and Ovarian Diseases
 Lung Diseases Antibodies  >2 publications with NUMA1 and Lung Diseases
 Ovarian Neoplasms Antibodies  >2 publications with NUMA1 and Ovarian Neoplasms
 Colorectal Neoplasms Antibodies  >2 publications with NUMA1 and Colorectal Neoplasms

Organs/Tissues associated with anti-NUMA1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >19 publications with NUMA1 and Blood
 Nerve Antibodies  >10 publications with NUMA1 and Nerve
 Bone Antibodies  >8 publications with NUMA1 and Bone
 Brain Antibodies  >7 publications with NUMA1 and Brain
 Skin Antibodies  >6 publications with NUMA1 and Skin
 Lung Antibodies  >6 publications with NUMA1 and Lung
 Connective Tissue Antibodies  >6 publications with NUMA1 and Connective Tissue
 Bone Marrow Antibodies  >6 publications with NUMA1 and Bone Marrow
 Kidney Antibodies  >5 publications with NUMA1 and Kidney
 Muscle Antibodies  >4 publications with NUMA1 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000