Mouse Anti-PLS1 Monoclonal Antibody – Cat# MBS6234576

PLS1 Antibody – Mouse Monoclonal

Name: PLS1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6234576
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6234576

MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PLS1, Monoclonal Antibody

Full Product Name

PLS1 (Plastin-1, Intestine-specific Plastin, I-plastin) (MaxLight 750)

Product Gene Name

anti-PLS1 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

3G10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human PLS1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

70kDa

OMIM

L20826 mRNA

3D Structure

ModBase 3D Structure for Q14651

Immunogen

Partial recombinant corresponding to aa1-103 from PLS1 (NP_002661) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI

Conjugate

MaxLight750

Product Categories/Family for anti-PLS1 antibody

Antibodies; Plastin

Applications Tested/Suitable for anti-PLS1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-PLS1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PLS1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PLS1 purchase

MBS6234576 is an antibody targeting PLS1. Also known as PLS1 (Plastin-1, Intestine-specific Plastin, I-plastin) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PLS1. It may not necessarily be applicable to this product.

NCBI GI #

223718246

NCBI GeneID

5357

NCBI Accession #

NP_002661

UniProt Primary Accession #

Q14651

UniProt Related Accession #

Q14651

GenBank Nucleotide #

NM_002670

NCBI Official Full Name

plastin-1

NCBI Official Synonym Full Names

plastin 1

NCBI Official Symbol

PLS1

UniProt Protein Name

Plastin-1

UniProt Synonym Protein Names

Intestine-specific plastin; I-plastin

Protein Family

1-acyl-sn-glycerol-3-phosphate acyltransferase

UniProt Gene Name

PLS1

UniProt Synonym Gene Names

I-plastin

NCBI Protein Information

plastin-1

NCBI Summary for PLS1

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. A pseudogene of this gene is found on chromosome 11.[provided by RefSeq, Feb 2010]

UniProt Comments for PLS1

PLS1: Actin-bundling protein in the absence of calcium.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: actin filament; actin filament bundle; brush border; cytoplasm

Molecular Function: actin filament binding; calcium ion binding; structural constituent of cytoskeleton

Biological Process: actin crosslink formation; actin filament bundle formation; actin filament network formation; D-glucose absorption; positive regulation of multicellular organism growth; regulation of microvillus length

Research Articles on PLS1

1. upregulated in eosinophils from atopic dermatitis patients

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.