Mouse Anti-RUFY1 Monoclonal Antibody – Cat# MBS6235133

RUFY1 Antibody – Mouse Monoclonal

Name: RUFY1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6235133
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6235133

MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000. More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RUFY1, Monoclonal Antibody

Full Product Name

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (MaxLight 750)

Product Gene Name

anti-RUFY1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3A5

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RUFY1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

610327

3D Structure

ModBase 3D Structure for Q96T51

Immunogen

Partial recombinant corresponding to aa376-475 from human RUFY1 (NP_079434) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQV

Conjugate

MaxLight750

Product Categories/Family for anti-RUFY1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

Applications Tested/Suitable for anti-RUFY1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-RUFY1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RUFY1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RUFY1 purchase

MBS6235133 is an antibody targeting RUFY1. Also known as RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RUFY1. It may not necessarily be applicable to this product.

NCBI GI #

94721336

NCBI GeneID

80230

NCBI Accession #

NP_079434

UniProt Primary Accession #

Q96T51

UniProt Related Accession #

Q96T51

GenBank Nucleotide #

NM_025158

NCBI Official Full Name

RUN and FYVE domain-containing protein 1 isoform a

NCBI Official Synonym Full Names

RUN and FYVE domain containing 1

NCBI Official Symbol

RUFY1

NCBI Official Synonym Symbols

RABIP4; ZFYVE12

UniProt Protein Name

RUN and FYVE domain-containing protein 1

UniProt Synonym Protein Names

FYVE-finger protein EIP1; La-binding protein 1; Rab4-interacting protein; Zinc finger FYVE domain-containing protein 12

Protein Family

RUN and FYVE domain-containing protein

UniProt Gene Name

RUFY1

UniProt Synonym Gene Names

RABIP4; ZFYVE12

UniProt Entry Name

RUFY1_HUMAN

NCBI Protein Information

RUN and FYVE domain-containing protein 1

NCBI Summary for RUFY1

This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

UniProt Comments for RUFY1

RUFY1: Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; lipid binding; protein transporter activity

Biological Process: protein transport; regulation of endocytosis; endocytosis

Research Articles on RUFY1

1. Data suggest that targeting the podocalyxin-like protein (PODXL)/RUN and FYVE domain containing 1 (RUFY1) complex might improve cancer therapy.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RUFY1 antibody

Reference Product	PubMed Publications
RAB4A antibody	>1 publications with RUFY1 and RAB4A
BMX antibody	>1 publications with RUFY1 and BMX

Pathways associated with anti-RUFY1 antibody

Products by Pathway	Pathway Diagram
Endocytosis Pathway antibodies	Endocytosis Pathway Diagram
Endocytosis Pathway antibodies	Endocytosis Pathway Diagram

Organs/Tissues associated with anti-RUFY1 antibody

Organ/Tissue Name	Pubmed Publications
Ovary Antibodies	>1 publications with RUFY1 and Ovary