Mouse Anti-TESK1 Monoclonal Antibody – Cat# MBS6235729

TESK1 Antibody – Mouse Monoclonal

Name: TESK1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6235729
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6235729

TESK1 is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases(LIMKs). TESK1 can… More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TESK1, Monoclonal Antibody

Full Product Name

TESK1 (Dual Specificity Testis-specific Protein Kinase 1, Testicular Protein Kinase 1) (MaxLight 750)

Product Gene Name

anti-TESK1 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1D11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TESK1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa266-365 from human TESK1 (AAH67130) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSP

Conjugate

MaxLight750

Product Categories/Family for anti-TESK1 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-TESK1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-TESK1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TESK1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TESK1 purchase

MBS6235729 is an antibody targeting TESK1. Also known as TESK1 (Dual Specificity Testis-specific Protein Kinase 1, Testicular Protein Kinase 1) (MaxLight 750). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TESK1. It may not necessarily be applicable to this product.

NCBI GI #

45501225

NCBI GeneID

7016

NCBI Accession #

BC067130

NCBI Related Accession #

AAH67130

UniProt Related Accession #

Q15569

NCBI Official Full Name

Homo sapiens testis-specific kinase 1, mRNA

NCBI Official Synonym Full Names

testis associated actin remodelling kinase 1

NCBI Official Symbol

TESK1

Protein Family

Dual specificity testis-specific protein kinase

NCBI Protein Information

dual specificity testis-specific protein kinase 1

NCBI Summary for TESK1

This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs). The encoded protein can phosphorylate myelin basic protein and histone in vitro. The testicular germ cell-specific expression and developmental pattern of expression of the mouse gene suggests that this gene plays an important role at and after the meiotic phase of spermatogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Research Articles on TESK1

1. In conclusion, deregulation of cytoskeleton dynamics through TESK1/CFL1 pathway underlies epithelial intestinal dysfunction in the small bowel mucosa of diarrhea-predominant irritable bowel syndrome, particularly in female patients.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.