Mouse Anti-TRIM63 Monoclonal Antibody – Cat# MBS6235892

TRIM63 Antibody – Mouse Monoclonal

Name: TRIM63 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6235892
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6235892

MBS6235892 is an antibody targeting TRIM63. Also known as TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite… More details

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TRIM63, Monoclonal Antibody

Full Product Name

TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)

Product Gene Name

anti-TRIM63 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

6G6

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TRIM63.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

36,950 Da

OMIM

606131

3D Structure

ModBase 3D Structure for Q969Q1

Immunogen

Partial recombinant corresponding to aa254-353 from human TRIM63 (NP_115977) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH

Conjugate

MaxLight750

Product Categories/Family for anti-TRIM63 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-TRIM63 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-TRIM63 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TRIM63 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TRIM63. It may not necessarily be applicable to this product.

NCBI GI #

19924163

NCBI GeneID

84676

NCBI Accession #

NP_115977

UniProt Primary Accession #

Q969Q1

UniProt Secondary Accession #

Q5T2I1; Q96BD3; Q96KD9; Q9BYV4; B4DN95

UniProt Related Accession #

Q969Q1

GenBank Nucleotide #

NM_032588

NCBI Official Full Name

E3 ubiquitin-protein ligase TRIM63

NCBI Official Synonym Full Names

tripartite motif containing 63, E3 ubiquitin protein ligase

NCBI Official Symbol

TRIM63

NCBI Official Synonym Symbols

IRF; SMRZ; MURF1; MURF2; RNF28

UniProt Protein Name

E3 ubiquitin-protein ligase TRIM63

UniProt Synonym Protein Names

Iris RING finger protein; Muscle-specific RING finger protein 1; MuRF-1; MuRF1; RING finger protein 28; Striated muscle RING zinc finger protein; Tripartite motif-containing protein 63

Protein Family

E3 ubiquitin-protein ligase

UniProt Gene Name

TRIM63

UniProt Synonym Gene Names

IRF; MURF1; RNF28; SMRZ; MuRF-1; MuRF1

UniProt Entry Name

TRI63_HUMAN

NCBI Protein Information

E3 ubiquitin-protein ligase TRIM63; iris ring finger protein; muscle specific ring finger protein 2; muscle-specific RING finger protein 1; ring finger protein 28; striated muscle RING zinc finger protein; tripartite motif-containing protein 63

UniProt Comments for TRIM63

MURF1: E3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric- associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.

Protein type: EC 6.3.2.-; Ligase; EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p34-p33

Cellular Component: microtubule; cytoplasm; M band; Z disc; nucleus

Molecular Function: signal transducer activity; protein binding; zinc ion binding; ubiquitin-protein ligase activity; titin binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; skeletal muscle atrophy; muscle contraction; regulation of gene expression; protein ubiquitination; response to electrical stimulus involved in regulation of muscle adaptation; signal transduction

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-TRIM63 antibody

Reference Product	PubMed Publications
TTN antibody	>6 publications with TRIM63 and TTN
SQSTM1 antibody	>3 publications with TRIM63 and SQSTM1
PKM2 antibody	>1 publications with TRIM63 and PKM2
MYOZ1 antibody	>1 publications with TRIM63 and MYOZ1
SUMO2 antibody	>1 publications with TRIM63 and SUMO2

Pathways associated with anti-TRIM63 antibody

Products by Pathway	Pathway Diagram
Adaptive Immune System Pathway antibodies	Adaptive Immune System Pathway Diagram
Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies	Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
Class I MHC Mediated Antigen Processing & Presentation Pathway antibodies	Class I MHC Mediated Antigen Processing & Presentation Pathway Diagram
Immune System Pathway antibodies	Immune System Pathway Diagram
TWEAK Signaling Pathway antibodies	TWEAK Signaling Pathway Diagram

Diseases associated with anti-TRIM63 antibody

Disease Name	Pubmed Publications
Atrophy Antibodies	>237 publications with TRIM63 and Atrophy
Nervous System Diseases Antibodies	>170 publications with TRIM63 and Nervous System Diseases
Muscular Atrophy Antibodies	>161 publications with TRIM63 and Muscular Atrophy
Hypertrophy Antibodies	>57 publications with TRIM63 and Hypertrophy
Disease Models, Animal Antibodies	>53 publications with TRIM63 and Disease Models, Animal
Weight Loss Antibodies	>43 publications with TRIM63 and Weight Loss
Necrosis Antibodies	>36 publications with TRIM63 and Necrosis
Cardiovascular Diseases Antibodies	>35 publications with TRIM63 and Cardiovascular Diseases
Inflammation Antibodies	>34 publications with TRIM63 and Inflammation
Heart Diseases Antibodies	>33 publications with TRIM63 and Heart Diseases

Organs/Tissues associated with anti-TRIM63 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>337 publications with TRIM63 and Muscle
Heart Antibodies	>58 publications with TRIM63 and Heart
Vascular Antibodies	>13 publications with TRIM63 and Vascular
Lung Antibodies	>13 publications with TRIM63 and Lung
Liver Antibodies	>12 publications with TRIM63 and Liver
Embryonic Tissue Antibodies	>9 publications with TRIM63 and Embryonic Tissue
Brain Antibodies	>5 publications with TRIM63 and Brain
Skin Antibodies	>2 publications with TRIM63 and Skin
Uncharacterized Tissue Antibodies	>1 publications with TRIM63 and Uncharacterized Tissue