Rabbit Anti-KLF8 Polyclonal Antibody – Cat# MBS6383682

KLF8 Antibody – Rabbit Polyclonal

Name: KLF8 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6383682
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6383682

Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G1 phase as a downstream target of focal adhesion kinase (FAK). More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

KLF8, Polyclonal Antibody

Full Product Name

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 650)

Product Gene Name

anti-KLF8 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human KLF8.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Full length human KLF8, aa1-359 (NP_009181.2).

Immunogen Sequence

MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM

Conjugate

MaxLight650

Note

Preservative Free

Product Categories/Family for anti-KLF8 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-KLF8 antibody

Western Blot (WB)

Application Notes for anti-KLF8 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-KLF8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KLF8 purchase

MBS6383682 is an antibody targeting KLF8. Also known as KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (MaxLight 650). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for KLF8. It may not necessarily be applicable to this product.

NCBI GI #

89111942

NCBI GeneID

11279

NCBI Accession #

NM_007250.3

UniProt Related Accession #

O95600

GenBank Nucleotide #

NM_007250.3

NCBI Official Full Name

Homo sapiens Kruppel-like factor 8 (KLF8), mRNA

NCBI Official Synonym Full Names

Kruppel like factor 8

NCBI Official Symbol

KLF8

NCBI Official Synonym Symbols

BKLF3; ZNF741

Protein Family

Krueppel-like factor

NCBI Protein Information

Krueppel-like factor 8

NCBI Summary for KLF8

This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

Research Articles on KLF8

1. KLF8-overexpressing hepatocellular carcinoma cells had a higher potential for inducing angiogenesis. The up-regulation of KLF8 increased VEGFA protein levels and induced VEGFA promoter activity by binding to the CACCC region of the VEGFA promoter.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.