Rabbit Anti-KPTN Polyclonal Antibody – Cat# MBS6383808

Western Blot analysis of KPTN expression in transfected 293T cell line by KPTN polyclonal antibody. Lane 1: KPTN transfected lysate (48.1kD). Lane 2: Non-transfected lysate.

KPTN Antibody – Rabbit Polyclonal

Name: KPTN Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6383808
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6383808

KPTN may be involved in actin dynamics. May play a role in producing the sensory apparatus in hair cells. May play a role in actin rearrangements that accompany platelet activation and stereocilia formation. More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

KPTN, Polyclonal Antibody

Full Product Name

KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin)

Product Gene Name

anti-KPTN antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human KPTN.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

21,583 Da

3D Structure

ModBase 3D Structure for Q9Y664

Immunogen

Full length human KPTN, aa1-436 (NP_008990.2).

Immunogen Sequence

MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS

Conjugate

Biotin

Note

Preservative Free

Product Categories/Family for anti-KPTN antibody

Antibodies; Actin

Applications Tested/Suitable for anti-KPTN antibody

Western Blot (WB)

Application Notes for anti-KPTN antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-KPTN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KPTN purchase

MBS6383808 is an antibody targeting KPTN. Also known as KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) (Biotin). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for KPTN. It may not necessarily be applicable to this product.

NCBI GI #

103471989

NCBI GeneID

11133

NCBI Accession #

NP_008990.2

UniProt Primary Accession #

Q9Y664

UniProt Secondary Accession #

Q96GT1; B3KN86; B4DQ76

UniProt Related Accession #

Q9Y664

GenBank Nucleotide #

NM_007059

NCBI Official Full Name

KICSTOR complex protein kaptin isoform 1

NCBI Official Synonym Full Names

kaptin, actin binding protein

NCBI Official Symbol

KPTN

NCBI Official Synonym Symbols

2E4; MRT41

UniProt Protein Name

KICSTOR complex protein kaptin

UniProt Synonym Protein Names

Actin-associated protein 2E4

Protein Family

Kaptin

UniProt Gene Name

KPTN

NCBI Protein Information

KICSTOR complex protein kaptin

NCBI Summary for KPTN

This gene encodes a filamentous-actin-associated protein, which is involved in actin dynamics and plays an important role in neuromorphogenesis. This protein is part of the KICSTOR protein complex that localizes to lysosomes. Mutations in this gene result in an autosomal recessive form of intellectual disability. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2017]

UniProt Comments for KPTN

As part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. Functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose.

Research Articles on KPTN

1. identification of a protein complex (KICSTOR) that is composed of four proteins, KPTN, ITFG2, C12orf66 and SZT2, and that is required for amino acid or glucose deprivation to inhibit mTORC1 in cultured human cells

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Organs/Tissues associated with anti-KPTN antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>1 publications with KPTN and Muscle
Intestine Antibodies	>1 publications with KPTN and Intestine
Blood Antibodies	>1 publications with KPTN and Blood
Embryonic Tissue Antibodies	>1 publications with KPTN and Embryonic Tissue
Brain Antibodies	>1 publications with KPTN and Brain