• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Muigfc Human Protein

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS666811

Information: Recombinant muIg control protein was engineered to be a negative control for muIg containing fusion proteins. More details

$605 / 0.025 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
muIgFc, Protein
Full Product Name
muIgFc-Purified (with Antibiotics)
Product Synonym Names
Recombinant muIg Control Protein
Host
CHO cells
Species Reactivity
Human
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Purity/Purification
Purified (with Antibiotics)
Concentration
0.5 mg/ml (lot specific)
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended
Molecular Structure
A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13) fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246) Predicted non glycosylated monomeric molecular weight: 27.8 kd. In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.
Transfectant Cell Line
CHO
Cells Tested
Human PBMC, HPB-MLT, Nalm-6, and Raji (cells were pre blocked with human IgG to prevent non specific binding).
Performance
Recombinant muIg was reactive in Goat anti-mouse Ig EIA. Product was tested as a negative control in Flow cytometry at 10 ug/ml using Goat anti-Mouse IgG/FITC as a 2 degree reagent. All cells tested failed to stain or display a significant mean shift above a buffer background.
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5 mg/ml Gentamicin Sulfate (as a preservative).
Group Header
muIgFc
Applications Tested/Suitable for muIgFc protein
Flow Cytometry (FC/FACS), ELISA (EIA)

Other Notes

Small volumes of muIgFc protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for muIgFc purchase

MBS666811 is a protein targeting muIgFc. Also known as muIgFc-Purified (with Antibiotics). Reactive in Human. Host: CHO cells.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000