• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Muigfc Human Protein

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS666830

Information: Recombinant muIg control protein was engineered to be a negative control for murine IgG2a Fc containing fusion proteins. More details

$605 / 0.025 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
muIgFc, Protein
Full Product Name
muIgFc-Biotin
Product Synonym Names
Recombinant muIg/Biotin Control Protein
Host
CHO cells
Species Reactivity
Human
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA.
Concentration
0.25 mg/ml (lot specific)
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.
Molecular Structure
A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13) fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246) Predicted non glycosylated monomeric molecular weight: 27.8 kd. In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.
Transfectant Cell Line
CHO
Cells Tested
Human PBMC, HPB-MLT, Nalm-6, U-937 and Raji (cells were pre blocked with human IgG to prevent non specific binding).
Performance
Recombinant muIg/Biotin was reactive in Goat anti-mouse Ig EIA utilizing SA/HRP as a detector. Product was tested as a negative control in Flow cytometry at 10 ug/ml using Streptavidin/R-PE) as a 2 degree reagent. All cells tested failed to stain or display a significant mean shift above a buffer background.
Conjugation
Biotin
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography), and reacted with NHS-Biotin. Unconjugated Biotin was removed from conjugate by size exclusion chromatography.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
Applications Tested/Suitable for muIgFc protein
Flow Cytometry (FC/FACS), ELISA (EIA)

Other Notes

Small volumes of muIgFc protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for muIgFc purchase

MBS666830 is a protein targeting muIgFc. Also known as muIgFc-Biotin. Reactive in Human. Host: CHO cells.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000